Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002668 (Dennd1c)
Chromosomal location
Chr 17: 57205479 - 57217933 (-)
Description
DENN/MADD domain containing 1C Gene [Source:MGI Symbol;Acc:MGI:1918035]
RefSeq_dna
NM_153551 
RefSeq_peptide
NP_705779.1 
MGI
MGI:1918035 
Uniprot/SWISSPROT
Q8CFK6 
Human Ortholog
ENSG00000205744 (DENND1C)
Omim not available
UniTrap UNI25903
Vector Insertion
Chr 17: 57214912 - 57216069
Public Clones not available
Private Clones OST153144 (lexicon) OST153091 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000011623
Sequence
AGGAAACTGAGCAGATCAGGGGCCCAGCCCCAAGCAAACACAGGCTCCCCCAGCCCCAGAAGCACTAGGGGAAAGGGCCCAGCTGGGCCAGCCCTGCAGA

GACCATGGGATCCACAGAGAC AAGGCATCCCCCTGCCATGTTTGACTGGTTCTTTGAAGCTGGCTGCCCCAACTCCCTGGAAGAGG ATCCCCCCATCC

TGCGGCAGTTCCCTCCAGACTTCCAGGAGCAG GAAGCCATGCAGATGGTGCCCAGGTTCTGTTTCCCCTTCGACATAGAAAG - UNI25903 - GGA

GCCACCCAGCCCTGCTGTTCAGCATTTCACCTTTGCCCTCACTGACCTGGTGGGCAACCGTAGATTTGGCTTCTGCCGCCTGCGAGCTGGTGCACGGAGT

TGTCTCTGTATCCTCAG CCACTTTCCCTGGTTTGAAGTGTTCTACAAGATTCTCAATAACGTGGGGGACCTTCTAGCCCAGAACCAA GTCGCCGAGGC

TGAAGAACTCCTACAAAACCTACAGCAACACCCACTTCTTGGACCCCGGTTTTCAGGAAGATCAGAGATG GACAGCAGCATCACTGTCCGGAGTGAATG

TGGAATCTTGCCTCCTGCCCTGGGGAATAGCAAGCTG CTTTCTTGTTTTGTGGCTCCGGATGCCGCCAGCCTGCCATCTATTCCTGAGAAT AGGAACC

TCACTGAGCTGGTGGTCGCTGTGACAGATGAGAACATCGTGGGGCTCTTCGCAGCGCTGCTAGCTGAGAGGAGGGTCTTGCTCACTGCCAGCAAGCTCAG

CACT CTGACAGCCTGTGTTCACGCATCCTGTGCCCTGCTCTACCCCATGCGCTGGGAGCACGTTCTGATCCCCACTCTACCCCCACACCTACTGGACTA

CTGCTG TGCGCCCATGCCCTACCTCATAGGAGTCCATGGCAGTCTCGCAGAG AGAGTCCGAGAAAAAGCGCTGGAAGATGTTGTGGTGTTGAATGCAG

ACTCTAACACCCTGGAGACACCCTTTGACGATGTGCAAGCTCTGCCGCCGGATGTG GTATCCCTGCTGAGGCTTCGGCTAAGGAAGGTTGCCCTGAGCC

CTGGGGAAGGGGTGTCCCGTCTCTTCCTCAAAGTGCAGGCCCTGCTCTTTGGAGGGTACCGTGATGCCCTTGTCTGCATCCCG GGTCAGCCAGTGACCT

TCAGTGAGGAAGCTTTTTTGGCTCAGAAGCCCGGGGCACCCCTGCAGGCATTCCACAAAAAGGCGGTACACTTGCAGCTGTTCAAGCAG TTCATCGAAT

CCCGACTGGAAAAACTCAATGCTGGGGAAGGCTTCTCAGACCAATTTGAGCAAGAGATCATTGCCTGCCGCGGAGCTTCCTCAG GCACCCTTCGGTCTT

ACCAGCTCTGGGTAGATAGTCTTAAG AAAGGTAGCGATGCCCTTCTGCATTCAATGAAGACAAAAACCCAACCAGCTGTCAGGAACATGTACCGATCG 

GGTGACTCCCTCCAGGAATATTGTGCATCAAAG GCAAAGAGTGGCTTGAAGGGTATGCAGAACCTGCTCACGATTAAG GATGGAGACTCTGGCCTGCA

GAGGGGGGGCTCCCTGAGAACCCCAAGCCTCACCAGCCGCTCTGATCGTCTGCAACAGCGCCTGCCTATTAGCCAGCACTTTGGACAG AACAGGCCCCT

CCGCCCCAGCAGGAGACTCAAGACTGAAGAGGGACCTTCCGAACCCCTGCGGGAGAG GAGCCCCACCTTGAGCCCTGGGGACACTCAGAACCCCTGGGC

AGAAGATACTCTAGATGGCAGCTTTCTGGGGTCTGGAGAAGAGCTGGATCTACTGAGTGAGATTCTAGACAGCCTGAACGTGGAAACCAAGAGTGGCGAC

CTGCAGAGGGCCAGCCAGAGCTTAGACTGCTGTCAGCGAGGGGCGGCGTCAGAGAGCTGCTCCAGCCTG CCTGACATCCCAGTGGGGTTACCATGGCAA

CTGGAAGAAGACAAGAGATCCCAGGATCCTCAGCCTTGGTCCCTACCTGGTGACCTGTCACTTCTGCAAGACACCCCATTTTCAGAGGTTGTAAGCTACT

CAAAGAACTCCTGTTCTCAGCCATTTCAGCAGAGCCCCCCAAGCCAAGGGGACCCCGGGCCCTCTCTCAGCAAGCTGGATCCTAGACCCTCACAAAGCCC

CTGCCCCAAGCTCCTCAGAGTCCCCACTAGGCACAGTCCTCCAGAAAGCCCCCAGCTTCTTGTCTCCACAGAGCCCAACTCTGATGCTGTCCAAAGATTA

CAATCCATTTCGTCTCCCTCATGCTCTCATTCTGCAGAGAACCCCAGAAACCAGCCTCCCCAGGTCCTCCTGGGCCAGGCTTGTGTACAACCCCTCGAGG

AGCTGGGAGCCCCCACTTATGTCTCTCATGTAAGCACGCAGCAAAGGCCACAGGACAAGCAACCTCGAGTTGCTGATCTGAAGAAGTGTTTCGAAAACTA

AGATAAGGAGTGTGAGGGGTTCCCAACTCTCAATAAAGCTGAATTTCTTTTCCTTG
Translation
MGSTET TRHPPAMFDWFFEAGCPNSLEED DPPILRQFPPDFQEQ EAMQMVPRFCFPFDIER - UNI25903 - REPPSPAVQHFTFALTDLVGNR

RFGFCRLRAGARSCLCILS SHFPWFEVFYKILNNVGDLLAQNQ VAEAEELLQNLQQHPLLGPRFSGRSEM DSSITVRSECGILPPALGNSKL LSCF

VAPDAASLPSIPEN RNLTELVVAVTDENIVGLFAALLAERRVLLTASKLST LTACVHASCALLYPMRWEHVLIPTLPPHLLDYCC CAPMPYLIGVHG

SLAE RVREKALEDVVVLNADSNTLETPFDDVQALPPDV VSLLRLRLRKVALSPGEGVSRLFLKVQALLFGGYRDALVCIP GQPVTFSEEAFLAQKPG

APLQAFHKKAVHLQLFKQ FIESRLEKLNAGEGFSDQFEQEIIACRGASSG GTLRSYQLWVDSLK KGSDALLHSMKTKTQPAVRNMYRS GDSLQEYC

ASK AKSGLKGMQNLLTIK DGDSGLQRGGSLRTPSLTSRSDRLQQRLPISQHFGQ NRPLRPSRRLKTEEGPSEPLRER RSPTLSPGDTQNPWAEDTL

DGSFLGSGEELDLLSEILDSLNVETKSGDLQRASQSLDCCQRGAASESCSSL PDIPVGLPWQLEEDKRSQDPQPWSLPGDLSLLQDTPFSEVVSYSKNS

CSQPFQQSPPSQGDPGPSLSKLDPRPSQSPCPKLLRVPTRHSPPESPQLLVSTEPNSDAVQRLQSISSPSCSHSAENPRNQPPQVLLGQACVQPLEELGA

PTYVSHVSTQQRPQDKQPRVADLKKCFEN

For any suggestions or comments, please send an email to unitrap@crg.es