Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002763 (Pex6)
Chromosomal location
Chr 17: 46848431 - 46862489 (+)
Description
peroxisomal biogenesis factor 6 Gene [Source:MGI (curated);Acc:Pex6-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38324
Vector Insertion
Chr 17: 46852432 - 46857276
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066348
Sequence
GTTTCCTTCTCCTTCGCCATGGCGTTGGCTGTCCTGCGCGTCCTGGACCCCTTCCCGACGGAGACACCACCGTTGGCGGTGCTGTTGCCTCCCGGGGGCC

CGTGGCCAGCGACGGGGCTGGGGCTGGTGCTGGCACTGCGGCCGGCGAGCGAGAGTCCCGCGAAGCCCGCGCTGCTCGTGGCGGCCGTGGAAGGGTCCGG

CGCCCAGGGCGAGCAGCGCGGGCCGGGGCCTCCGCCGCTGCTGGTGAGCCGCGCGCTGCTGCGGGTCCTAGCGCTGGGGCCCGGGGCGCGAGTACGAGCG

CGGCTTGTGCGGCGTCCCCCGGCCCTGGGCTGGGCGTTGCTTGCCACGGCTCCGGGACCCGGGCTAGGGCCTCGAGTCGGGCCGCTGTTGGTGCGCCGCG

GGGAGACCCTCCCCGTGCCCGGATCGCGAGTGTTGGAGACGCGACCGGCCCTGCAGGGGTTGCTGGGCCCGGGGACACGGCTGGCCGTGACTGAGCTCCG

CGGGCGGGCCAAACTGGGCCAGGAGAGTCGGGATCACAGCCATCCCCCGCCCCCGCCCGTAGTGTCGTCCTTTGCAGCTTCCCACTCGGTCCGGCGACTC

CGAGGGGTTCTGGGAGGGACTGGAGATGCGCTGGGTGTGAGCCGGAGCTGTCTCCGGAGTCTCGGACTCTTCCAGGGCGAATGGGTCTGGGTGGCCCAGG

TCGCAGAGTTACCCAACTCCTCGCAGCCGCGCTTGGCTCAAGTCCAGGTTCTAGAACCGCGCTGGGAGCTGTCTGAGAGACTGGGACCCAACTCCGGGCA

GCAGCCGGGAGAGCCACTCGCTGACGGACTGGTGTTTCTGCCCGCCACTCTGGCTTTTAATCTCGGCTGTGACCCCCTGGAAGTGGGAGAGCTCAGAATT

CAG AGGTATTTGGAAGGCTCCATCGCCCCAGAGAACAAAGGAAGCTGTTCACCACTGCCCGGGCCTCCGTTTGCTCGAGAGTTACACATTGAGATTCTG

TCCTCGCCTCACTACAGTGCTAATGGAAATTATGACCATGTCCTGTACCGGCACTTTCAGACACCCAG GGTGGTCCAGGAAGGGGATGTGTTGTGTGTG

TCAACAGCTGGGCAAGTTGAGATCCTGGAAGGAAGCCTGGAGAGACTGCCCAG GGTCTCTACCTCATCCTGTGTCCTATGCCAAGAGAGACACCTGCCA

CGAATGCCTGCCTCATCTTGTCAACATCCAGAGCTTGGTTCCTGTTGGTGCGCAGTGCTCCCTATCTCAAGATAG
Translation
MALAVLRVLDPFPTETPPLAVLLPPGGPWPATGLGLVLALRPASESPAKPALLVAAVEGSGAQGEQRGPGPPPLLVSRALLRVLALGPGARVRARLVRRP

PALGWALLATAPGPGLGPRVGPLLVRRGETLPVPGSRVLETRPALQGLLGPGTRLAVTELRGRAKLGQESRDHSHPPPPPVVSSFAASHSVRRLRGVLGG

TGDALGVSRSCLRSLGLFQGEWVWVAQVAELPNSSQPRLAQVQVLEPRWELSERLGPNSGQQPGEPLADGLVFLPATLAFNLGCDPLEVGELRIQ RYLE

GSIAPENKGSCSPLPGPPFARELHIEILSSPHYSANGNYDHVLYRHFQTPR RVVQEGDVLCVSTAGQVEILEGSLERLPR RVSTSSCVLCQERHLPRM

PASSCQHPELGSCWCAVLPISR
Transcript ENSMUST00000002840
Sequence
GTTTCCTTCTCCTTCGCCATGGCGTTGGCTGTCCTGCGCGTCCTGGACCCCTTCCCGACGGAGACACCACCGTTGGCGGTGCTGTTGCCTCCCGGGGGCC

CGTGGCCAGCGACGGGGCTGGGGCTGGTGCTGGCACTGCGGCCGGCGAGCGAGAGTCCCGCGAAGCCCGCGCTGCTCGTGGCGGCCGTGGAAGGGTCCGG

CGCCCAGGGCGAGCAGCGCGGGCCGGGGCCTCCGCCGCTGCTGGTGAGCCGCGCGCTGCTGCGGGTCCTAGCGCTGGGGCCCGGGGCGCGAGTACGAGCG

CGGCTTGTGCGGCGTCCCCCGGCCCTGGGCTGGGCGTTGCTTGCCACGGCTCCGGGACCCGGGCTAGGGCCTCGAGTCGGGCCGCTGTTGGTGCGCCGCG

GGGAGACCCTCCCCGTGCCCGGATCGCGAGTGTTGGAGACGCGACCGGCCCTGCAGGGGTTGCTGGGCCCGGGGACACGGCTGGCCGTGACTGAGCTCCG

CGGGCGGGCCAAACTGGGCCAGGAGAGTCGGGATCACAGCCATCCCCCGCCCCCGCCCGTAGTGTCGTCCTTTGCAGCTTCCCACTCGGTCCGGCGACTC

CGAGGGGTTCTGGGAGGGACTGGAGATGCGCTGGGTGTGAGCCGGAGCTGTCTCCGGAGTCTCGGACTCTTCCAGGGCGAATGGGTCTGGGTGGCCCAGG

TCGCAGAGTTACCCAACTCCTCGCAGCCGCGCTTGGCTCAAGTCCAGGTTCTAGAACCGCGCTGGGAGCTGTCTGAGAGACTGGGACCCAACTCCGGGCA

GCAGCCGGGAGAGCCACTCGCTGACGGACTGGTGTTTCTGCCCGCCACTCTGGCTTTTAATCTCGGCTGTGACCCCCTGGAAGTGGGAGAGCTCAGAATT

CAG AGGTATTTGGAAGGCTCCATCGCCCCAGAGAACAAAGGAAGCTGTTCACCACTGCCCGGGCCTCCGTTTGCTCGAGAGTTACACATTGAGATTCTG

TCCTCGCCTCACTACAGTGCTAATGGAAATTATGACCATGTCCTGTACCGGCACTTTCAGACACCCAG GGTGGTCCAGGAAGGGGATGTGTTGTGTGTG

TCAACAGCTGGGCAAGTTGAGATCCTGGAAGGAAGCCTGGAGAGACTGCCCAG - UNI38324 - GTGGCGGGAGATGTTTTTCAAAGTGAAGAAAAC

GGTTGGAGAAGCCCCAGAGGGGCCAGCCAGTGCCTTTCTGGCTGATACCACCCACACCTCTTTATACCTG GCTGGCACCGCCCTGAGTCATGTGCCATC

GCTGCCTTCAGGAAGGTCCCCACCCTGGGACAGCTTGTCTCCTCCAGGCCTGGAGGCCTTGGTAAATGAGCTGTGTGCTATCCTGAAGCCTCACCTGCAG

CCCGG AGGAACATTGCTCACAGGAACCAGCTGTGTGCTTCTGCAGGGTCCCCCAGGCAGCGGGAAGACCACAGCCGTCACGGCTGCATGCAGCCGCCTT

GGGCTCCATTTGCTGAAG GTGCCCTGCTCCAGCCTCTGTGCAGACAGCAGTAGGGCCGTGGAGACAAAGCTGCAGGCCACCTTCTCCCGGGCCCGCCGC

TGCAGGCCTGCAGTCCTCCTGTTGACAGCTGTGGACCTCCTGGGCCGGGACCGAGACGGACTGGGTGAGGATGCCCGTGTTGCGGCCACACTCCGTCATC

TCCTCCTTGATGAGGACGCTCTCAGCAG GTGCCCTCCTCTCATGGTGGTGGCTACCACAAGCCGTGTCCAGGACCTGCCCACCGATGTGCAGACGGCAT

TTCCTCATGAGCTAGAGGTGCCAGTGCTGTCTGAGGCTCAACGGCTCAGTATCCTGCAGGCCCTCACTGCCCACCTTCCCTTAGGCCAGGAGGTTAACCT

GCCCCAGCTGGCACGGCGCTGTGCG GGCTTTGTGGTGGGGGACCTCTATGCCCTTCTGACCCATACCTGCCGGGCAGCCTGCACCAGGATCAGAGCCTC

GGG CTCGGCAGGTGGTTTGAGTGAGGAGGATGAGGGGGACCTGTGTGTGGCTGGCTTTCCTTTGCTGGCTGAGGACTTCGGGCAGGCATTAGATCAACT

GCAGACAGCTCACTCCCAAGCTGTGGGAGCACCCAGG ATCCCTTCAGTGTCCTGGCACGACGTGGGCGGGCTGCAGGATGTGAAGAAGGAGATCCTAGA

AACCATCCAGCTGCCTCTGGAACACCCTGAGCTGCTCAGCCTGGGCCTAAGACGATCAGGCCTTCTGCTCCATGGGCCCCCAGGCACTGGCAAGACCCTG

CTGGCCAAGGCCGTAGCCACTGAGTGCAGCCTCACCTTCCTCAG TGTAAAGGGACCGGAGCTCATCAACATGTATGTGGGCCAAAGCGAGGAGAATGTC

CGGGAAG TGTTTGCCAGGGCCAGGGCTGCTGCTCCCTGTATCATCTTCTTTGATGAACTGGATTCCTTAGCTCCAAGCCGCGGACGGAGTGGAGATTCT

GGAGGGGTGATGGACAG AGTTGTGTCTCAGCTCCTAGCCGAGCTGGATGGGCTCCACAGCACCCAGGATGTGTTTGTGATCGGAGCCACCAACAGACCA

GACCTCCTGGACCCTGCCCTTCTGCGGCCTGGCAG ATTTGACAAGCTGGTGTTTGTAGGGGCGAGTGAGGACCGGGCCTCCCAGCTGCGTGTGCTGAGC

GCCATCACACGGAA GTTCAAGCTGGAGGCCTCTGTGAGCCTGGCAAACGTGCTGGATTGCTGCCCACCCCAGCTGACTGGTGCAGATCTCTATTCTCTC

TGCTCTGACGCCATGATGACTGCCCTCAAACGCAGGGTTCGAGACCTAGAGGAAG GGCTAGAGCTGCGGAGCTCAGCACTGCTGCTCACCATGGAGGAC

CTGTTGCAGGCTGCAGCCCGGCTGCAGCCCTCAGTCAGTGAGCAGGAGCTGTTGCGATACAAGCGCATCCAACGCAAGTTTGCCGCCTGCTAGGAGCTGC

CTGCCTGCCCTCTGCCTATGCCCCCTGACTGAAGGTACCTCCCGCCTGTCGCCTGAAGGCTGCCTCCTCCCAGAGATCCCTTGTGAGCCCTAGTGGGGGC

CCCTAGTGCTCAGGAGGAGAGGCAGGGCTGGCAGCTAGGGGCTTGGCAGCCTGTGACCTGTGCGGAGACACTAGTTCTGGAGTAGAAAATAAAGTGTATA

CTGCCTCCT
Translation
MALAVLRVLDPFPTETPPLAVLLPPGGPWPATGLGLVLALRPASESPAKPALLVAAVEGSGAQGEQRGPGPPPLLVSRALLRVLALGPGARVRARLVRRP

PALGWALLATAPGPGLGPRVGPLLVRRGETLPVPGSRVLETRPALQGLLGPGTRLAVTELRGRAKLGQESRDHSHPPPPPVVSSFAASHSVRRLRGVLGG

TGDALGVSRSCLRSLGLFQGEWVWVAQVAELPNSSQPRLAQVQVLEPRWELSERLGPNSGQQPGEPLADGLVFLPATLAFNLGCDPLEVGELRIQ RYLE

GSIAPENKGSCSPLPGPPFARELHIEILSSPHYSANGNYDHVLYRHFQTPR RVVQEGDVLCVSTAGQVEILEGSLERLPR - UNI38324 - RWREM

FFKVKKTVGEAPEGPASAFLADTTHTSLYL AGTALSHVPSLPSGRSPPWDSLSPPGLEALVNELCAILKPHLQPG GGTLLTGTSCVLLQGPPGSGKTT

AVTAACSRLGLHLLK VPCSSLCADSSRAVETKLQATFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVAATLRHLLLDEDALSR RCPPLMVVATTSR

VQDLPTDVQTAFPHELEVPVLSEAQRLSILQALTAHLPLGQEVNLPQLARRCA GFVVGDLYALLTHTCRAACTRIRASG GSAGGLSEEDEGDLCVAGF

PLLAEDFGQALDQLQTAHSQAVGAPR IPSVSWHDVGGLQDVKKEILETIQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLS SVK

GPELINMYVGQSEENVREV VFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDR RVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGR R

FDKLVFVGASEDRASQLRVLSAITRK KFKLEASVSLANVLDCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEG GLELRSSALLLTMEDLLQAAARLQ

PSVSEQELLRYKRIQRKFAAC

For any suggestions or comments, please send an email to unitrap@crg.es