Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002767 (Mrpl2)
Chromosomal location
Chr 17: 46783197 - 46787088 (+)
Description
mitochondrial ribosomal protein L2 Gene [Source:MGI (curated);Acc:Mrpl2-001]
RefSeq_dna
NM_025302 
RefSeq_peptide
NP_079578.1 
MGI
MGI:1351622 
Uniprot/SWISSPROT
Q9D773 
Uniprot/SPTREMBL
B1B1D7 B1B1D8 B1B1D6 
Human Ortholog
ENSG00000112651 (MRPL2)
Omim not available
UniTrap UNI3031
Vector Insertion
Chr 17: 46783218 - 46783348
Public Clones XP0416 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26009
Vector Insertion
Chr 17: 46783348 - 46784338
Public Clones not available
Private Clones OST146521 (lexicon) OST144700 (lexicon) OST70129 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18558
Vector Insertion
Chr 17: 46784344 - 46784508
Public Clones not available
Private Clones OST420759 (lexicon) OST418471 (lexicon) OST218484 (lexicon) OST173990 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26281
Vector Insertion
Chr 17: 46784508 - 46785185
Public Clones not available
Private Clones OST127022 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36989
Vector Insertion
Chr 17: 46786058 - 46786832
Public Clones CMHD-GT_543F4-5S (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20551
Vector Insertion
Chr 17: 46786832 - 46787082
Public Clones CMHD-GT_543F4-3 (cmhd)
Private Clones OST358973 (lexicon) OST128823 (lexicon) OST71346 (lexicon) OST31829 (lexicon)
OST29837 (lexicon) OST24708 (lexicon) OST18515 (lexicon) OST10927 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113429
Sequence
AGGCTCTGGATGAAGGTAAAAGCGAGCACGGCGCGGAGGAGCCCGGCCGGCCCATGGCGCTGTGTGCGCTGACGAGTGCTCTGCGCTCTTTGAGCCTGGC

ATCCGCGGCCATTACCGCCCGGGTTCCGACTCTGCTCCCTGCTGCCCAG - UNI3031 - - UNI26009 - ATACAGAGCAATGTCCTCCTTCAGC

TGCCCCCTGCCTTGGTGTCGCCCTCTTACCGCCCAGTGCATATGTCTGCGGACCGCAGTGCCAAGTTTGTGTCCTGGAAGAGTCGTACCAAGTACACAGT

TAAACCAGTGAAGATGAGGAAGTCTGGGGGTCGAGACCATACAG - UNI18558 - - UNI26281 - GCCGCATCCGAGTGCATGGTATCGGTGGA

GGCCACAAACAGAATTATCGCATGATTGACTTTCTACGGTTCCGGCCAGAAAAGGAAAAGGCACCAGAACCGTTTGAGGAGAAGGTTGTGGTAGTCCGCT

ATGATCCTTGTAG GTCTGCAGACATAGCTCTGGTTGCTGGGGGTAGCCGGAAGCGCTGGATCATTGCCACGGAAAACATGAAGGCTGGAGATACAATCC

TGAACTCTAATCACATAGGCAGGATGGCAG GAGGGGGATGCACATCCACTTGGGGCGCTGCCTGTGGGGACCCTCATCAACAACGTAGAGAGCGAGCCT

GGCCGGGGAGCCCAGTATATCCGAGCTGCAG GGACATGCGGTGTGCTGCTTCGGAAGGTGAACGGGACAGCCATTATCCAGCTGCCCTCGAAGAGGCAA

ATGCAG - UNI20551 - GTGCTGGAGTCATGCACTGCAACTGTAGGCCGAGTATCCAACGTTAACCATAACCAGCGGGTCATCGGCAAGGCAGGAAG

GAACCGCTGGCTGGGCAAGAGGCCTAACAGTGGGCTGTGGCAACGCAAGGGAGGCTGGGCCGGCCGAAAGATTCGGCCACTACCACCCATGAAGAGTTAT

GTGAAGCTGCCCTCCGCTGCTGCCCAAAACTGATTGCCCTGGACTCTAATAAAATGTCTCTTGTTTTT
Translation
MALCALTSALRSLSLASAAITARVPTLLPAAQ - UNI3031 - - UNI26009 - IQSNVLLQLPPALVSPSYRPVHMSADRSAKFVSWKSRTKYTV

KPVKMRKSGGRDHTG - UNI18558 - - UNI26281 - GRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPCR RSADIALVA

GGSRKRWIIATENMKAGDTILNSNHIGRMAG GGGCTSTWGAACGDPHQQRRERAWPGSPVYPSCR RDMRCAASEGERDSHYPAALEEANAG - UNI2

0551 - GAGVMHCNCRPSIQR
Transcript ENSMUST00000113430
Sequence
AGCGAGCACGGCGCGGAGGAGCCCGGCCGGCCCATGGCGCTGTGTGCGCTGACGAGTGCTCTGCGCTCTTTGAGCCTGGCATCCGCGGCCATTACCGCCC

GGGTTCCGACTCTGCTCCCTGCTGCCCAG - UNI3031 - - UNI18558 - - UNI26009 - AGCAATGTCCTCCTTCAGCTGCCCCCTGCCTT

GGTGTCGCCCTCTTACCGCCCAGTGCATATGTCTGCGGACCGCAGTGCCAAGTTTGTGTCCTGGAAGAGTCGTACCAAGTACACAGTTAAACCAGTGAAG

ATGAGGAAGTCTGGGGGTCGAGACCATACAG - UNI18558 - - UNI26281 - GCCGCATCCGAGTGCATGGTATCGGTGGAGGCCACAAACAGA

ATTATCGCATGATTGACTTTCTACGGTTCCGGCCAGAAAAGGAAAAGGCACCAGAACCGTTTGAGGAGAAGGTTGTGGTAGTCCGCTATGATCCTTGTAG

 GTCTGCAGACATAGCTCTGGTTGCTGGGGGTAGCCGGAAGCGCTGGATCATTGCCACGGAAAACATGAAGGCTGGAGATACAATCCTGAACTCTAATCA

CATAGGCAGGATGGCAG TGGCCGCCCAGGAGGGGGATGCACATCCACTTGGGGCGCTGCCTGTGGGGACCCTCATCAACAACGTAGAGAGCGAGCCTGG

CCGGGGAGCCCAGTATATCCGAGCTGCAG GGACATGCGGTGTGCTGCTTCGGAAGGTGAACGGGACAGCCATTATCCAGCTGCCCTCGAAGAGGCAAAT

GCAG - UNI20551 - GTGCTGGAGTCATGCACTGCAACTGTAGGCCGAGTATCCAACGTTAACCATAACCAGCGGGTCATCGGCAAGGCAGGAAGGA

ACCGCTGGCTGGGCAAGAGGCCTAACAGTGGGCTGTGGCAACGCAAGGGAGGCTGGGCCGGCCGAAAGATTCGGCCACTACCACCCATGAAGAGTTATGT

GAAGCTGCCCTCCGCTGCTGCCCAAAACTGATTGCCCTGGACTCTAATAAAATGTCTCTTGTTTTTATCTCTTA
Translation
MALCALTSALRSLSLASAAITARVPTLLPAAQ - UNI3031 - - UNI18558 - - UNI26009 - SNVLLQLPPALVSPSYRPVHMSADRSAKF

VSWKSRTKYTVKPVKMRKSGGRDHTG - UNI18558 - - UNI26281 - GRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPC

R RSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAV VAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAG GTCGVLLRKVNGTAIIQL

PSKRQMQ - UNI20551 - VLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQN
Transcript ENSMUST00000002844
Sequence
CCAGGCTCTGGATGAAGGTAAAAGCGAGCACGGCGCGGAGGAGCCCGGCCGGCCCATGGCGCTGTGTGCGCTGACGAGTGCTCTGCGCTCTTTGAGCCTG

GCATCCGCGGCCATTACCGCCCGGGTTCCGACTCTGCTCCCTGCTGCCCAG - UNI3031 - - UNI26009 - ATACAGAGCAATGTCCTCCTTCA

GCTGCCCCCTGCCTTGGTGTCGCCCTCTTACCGCCCAGTGCATATGTCTGCGGACCGCAGTGCCAAGTTTGTGTCCTGGAAGAGTCGTACCAAGTACACA

GTTAAACCAGTGAAGATGAGGAAGTCTGGGGGTCGAGACCATACAG - UNI18558 - - UNI26281 - GCCGCATCCGAGTGCATGGTATCGGTG

GAGGCCACAAACAGAATTATCGCATGATTGACTTTCTACGGTTCCGGCCAGAAAAGGAAAAGGCACCAGAACCGTTTGAGGAGAAGGTTGTGGTAGTCCG

CTATGATCCTTGTAG GTCTGCAGACATAGCTCTGGTTGCTGGGGGTAGCCGGAAGCGCTGGATCATTGCCACGGAAAACATGAAGGCTGGAGATACAAT

CCTGAACTCTAATCACATAGGCAGGATGGCAG TGGCCGCCCAGGAGGGGGATGCACATCCACTTGGGGCGCTGCCTGTGGGGACCCTCATCAACAACGT

AGAGAGCGAGCCTGGCCGGGGAGCCCAGTATATCCGAGCTGCAG GGACATGCGGTGTGCTGCTTCGGAAGGTGAACGGGACAGCCATTATCCAGCTGCC

CTCGAAGAGGCAAATGCAG - UNI20551 - GTGCTGGAGTCATGCACTGCAACTGTAGGCCGAGTATCCAACGTTAACCATAACCAGCGGGTCATCG

GCAAGGCAGGAAGGAACCGCTGGCTGGGCAAGAGGCCTAACAGTGGGCTGTGGCAACGCAAGGGAGGCTGGGCCGGCCGAAAGATTCGGCCACTACCACC

CATGAAGAGTTATGTGAAGCTGCCCTCCGCTGCTGCCCAAAACTGATTGCCCTGGACTCTAATAAAATGTCTCTTGTTTTTA
Translation
MALCALTSALRSLSLASAAITARVPTLLPAAQ - UNI3031 - - UNI26009 - IQSNVLLQLPPALVSPSYRPVHMSADRSAKFVSWKSRTKYTV

KPVKMRKSGGRDHTG - UNI18558 - - UNI26281 - GRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPCR RSADIALVA

GGSRKRWIIATENMKAGDTILNSNHIGRMAV VAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAG GTCGVLLRKVNGTAIIQLPSKRQMQ - U

NI20551 - VLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQN

For any suggestions or comments, please send an email to unitrap@crg.es