Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002833 (Hdgfrp2)
Chromosomal location
Chr 17: 56219080 - 56240019 (+)
Description
hepatoma-derived growth factor, related protein 2 Gene [Source:MGI Symbol;Acc:MGI:1194492]
RefSeq_dna
NM_008233 
RefSeq_peptide
NP_032259.1 
MGI
MGI:1194492 
Uniprot/SWISSPROT
Q3UMU9 
Human Ortholog
ENSG00000167674 (AC011498.7-201)
Omim not available
UniTrap UNI3694
Vector Insertion
Chr 17: 56219250 - 56221522
Public Clones (sanger) AQ0352 (sanger) AQ0044 (sanger) AF0511 (sanger) RRK473 (baygenomics)
RRR016 (baygenomics) E061D02 (ggtc)
Private Clones OST34422 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35173
Vector Insertion
Chr 17: 56221600 - 56221699
Public Clones IST14357H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6936
Vector Insertion
Chr 17: 56221839 - 56232944
Public Clones RRK507 (baygenomics) RRZ557 (baygenomics) IST12291G12 (tigm)
Private Clones OST278088 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12288
Vector Insertion
Chr 17: 56237409 - 56237906
Public Clones A044F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12083
Vector Insertion
Chr 17: 56238811 - 56239281
Public Clones A060B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002911
Sequence
GTGCGGACGCCTCCGCCCCTCAGGCGTCCGACTCCCGCCTCTGACTTCGCCTCTCACCGCCGTTGCTGCTTCCCGCGGCCTGGGCCTCCGCCGACAGCAT

GCCGCACGCCTTCAAGCCCGGGGACTTGGTGTTTGCCAAGATGAAGGGCTACCCGCACTGGCCGGCCCGG - UNI3694 - ATTGATGACATTGCTGA

TGGTGCCGTGAAGCCCCCACCCAACAAATACCCCATCTTCTTCTTTGGAACGCATGAAAC GGCCTTCCTGGGACCCAAGGACCTGTTCCCCTATGATAA

GTGCAAGGACAAGTACGGAAAGCCCAACAAGAGGAAAGGCTTCAATGAGGGGCTCTGGGAGATCCAGAACAACCCCCATGCCAGCTACAGTGCGCCTCCG

 - UNI6936 - CCGGTGAGCTCCTCTGACAGTGAGGCCCCTGAAGCCGACCTGGGTTGTGGCAGCGACGTGGACAAGGACAAAGAATCCCGGAGGGTC

ATGACTGTGACAGCTGTGACCACCACAGCCACCAGTGACAGGATGGAGAGCGATTCTGACTCTGACAAGAGCAGTGATCACAGTGGCCTGAAGCGGAAGA

CACCAGTCTTGAAG GTGTCAGTCTCTAAACGAGCTAGAAGAGCTTCCAGTGACCTGGATCAGGCCAGTGTGTCCCCATCAGAAGAGGACTCTGAGAGCC

CATCTGAGTCGGAGAAGACCAGTGACCAG GATTTTACCCCAGAGAAGAAGACAGCGGCCCGGCCGCCACGGCGAGGTCCTCTGGGAGGACGCAAGAAGA

AG AAGGTGCCATCAGCCTCGGATTCAGACTCCAAAGCCGACTCAGATGGGGCCAAGGAGGAGCCTGTGGTTACAGCACAGCCGTCTCCATCCTCCTCGT

CGTCGTCCTCATCATCATCCTCCTCAGACTCAGATGTGTCTGTCAAGAAACCCCCTCGAGGTAGAAAGCCAG CTGAGAAGCCACCCCCAAAACCCCGAG

GGCGGAGACCAAAGCCAGAACGACCACCTTCCACCTCCAGCAGTGACAG TGACAGTGACAGTGGTGAAGTAGACCGCATCAGTGAATGGAAGAGACGTG

ATGAAGAGCGAAGGCGTGAGCTGGAGGCTCGGAGGCGACGGGAGCAGGAGGAAGAGCTCCGGAGACTTCGAGAACAGGAGAGGGAGGAGAAGGAGCGGCG

CAAGGAGCGGGCAGAGCGTGGGGGCAGCAGTGGAGAGGAGCTGGAGGACGAGGAGCCTGTGAAGAAGCGTAGCCGAAAGGCTCGAGGCCGAGGCACACCA

TCCTCCTCTGACTCAGAACCTGAGGGGGAGCTTGGGAAAGAG GGGAAGAAGTTGGCCAAGAAGTCCCAACTGCCAGGCTCAGAGTCTGCAAGGAAGCCT

GGGCAAAAGGAGAAGAGAGGGCGGCCAGATGAGAAGCCACGAGCCAG - UNI12288 - GCCTGTGAAGGTGGAGCGGACGCGGAAGCGGTCAGAGGG

TCTCTCACTGGAAAGGAAGGGGGAGAAGAAGAAAG AACCCTCCGTAGAGGAGAGACTGCAAAAGCTGCACAGCGAGATCAAATTTGCACTGAAGGTTGA

CAACCCA GATGTGAGGAAGTGTCTGAGTGCACTGGAAGAACTGGGGACTCTGCAGGTAACCTCTCAGATTCTTCAGAAGAACACAGATGTGGTAGCAAC

GCTGAAGAAG ATTCGCCGGTACAAGGCCAACAAGGATGTGATGGCGAAGGCAGCAGAGGTCTACACCCGGCTCAAGTCACGGGTCCTGGGGCCGAAAGT

TGAGGCTCTCCAGAAGGTGAACAAGGCTGGAGCCGAGAAGGAACGGGCCGATAACGAGAAGCTAGAGGAGCAGCCGGGGGAGCAGGCTCCCAGAGAGCTG

GCAGAGGATGAGCCCAGCACCG - UNI12083 - ATCGGTCAGCACCTGTGAATGGTGAGGCCACATCCCAGAAGGGGGAGAACATGGAAGACAGAGC

ACAGGAAGACGGGCAGGACTCTGAAGATGGCCCCAGGGGTGGCTCCTCAGAAGAGCTGCATGA CAGCCCACGCGACAACTCGGACCCAGCCAAGCCTGG

AAATGAGCGTCAGGACCATGAGAGGACACGGCTGGCCTCTGAGTCTGCCAATGATGACAATGAGGACAGCTGAGCTCCAGCCACTGTGGCCATGGTGCCA

TGTCCATCCCCAGCCTCCCAGGGAAGTGCTGCGCTGTTTGTATTTGTGGTCTGGGCTTTTCTGCCTAGTTCTGTGATTTCAATTGACATGAAATGGCTAT

AAAGAATTTTGTAATG
Translation
MPHAFKPGDLVFAKMKGYPHWPAR - UNI3694 - IDDIADGAVKPPPNKYPIFFFGTHET TAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQ

NNPHASYSAPP - UNI6936 - PVSSSDSEAPEADLGCGSDVDKDKESRRVMTVTAVTTTATSDRMESDSDSDKSSDHSGLKRKTPVLK VSVSKRAR

RASSDLDQASVSPSEEDSESPSESEKTSDQ DFTPEKKTAARPPRRGPLGGRKKK KVPSASDSDSKADSDGAKEEPVVTAQPSPSSSSSSSSSSSSDSD

VSVKKPPRGRKPA AEKPPPKPRGRRPKPERPPSTSSSDS SDSDSGEVDRISEWKRRDEERRRELEARRRREQEEELRRLREQEREEKERRKERAERGG

SSGEELEDEEPVKKRSRKARGRGTPSSSDSEPEGELGKE GKKLAKKSQLPGSESARKPGQKEKRGRPDEKPRAR - UNI12288 - RPVKVERTRKR

SEGLSLERKGEKKKE EPSVEERLQKLHSEIKFALKVDNP DVRKCLSALEELGTLQVTSQILQKNTDVVATLKK IRRYKANKDVMAKAAEVYTRLKSR

VLGPKVEALQKVNKAGAEKERADNEKLEEQPGEQAPRELAEDEPSTD - UNI12083 - DRSAPVNGEATSQKGENMEDRAQEDGQDSEDGPRGGSSE

ELHD DSPRDNSDPAKPGNERQDHERTRLASESANDDNEDS

For any suggestions or comments, please send an email to unitrap@crg.es