Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002871 (Gpr175)
Chromosomal location
Chr 6: 88852245 - 88862234 (+)
Description
G protein-coupled receptor 175 Gene [Source:MGI (curated);Acc:Gpr175-001]
RefSeq_dna
NM_011906 
RefSeq_peptide
NP_036036.2 
UniGene
Mm.284480 
MGI
MGI:1345190 
Uniprot/SWISSPROT
Q99MU1 
Human Ortholog
ENSG00000163870 (GPR175)
Omim not available
UniTrap UNI23085
Vector Insertion
Chr 6: 88852525 - 88855942
Public Clones not available
Private Clones OST276949 (lexicon) OST234741 (lexicon) OST191632 (lexicon) OST186852 (lexicon)
OST89851 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055022
Sequence
TGGAGGCCGAGGGGGCGGGGATGAGTGCCACAAACAGGGGTTGTGACTGTTTTCACAGTTTTGCTTAGACGAAAAACACTAGCCAAGGCGCCTGAGAGTC

GCCGCTGCCAGGGGAGGACCGGGGAAGTCCGCGGGTCCCGTGAGTCCTGCGCGCTGGCGGCGTCCGGCCACCTCTGACCGATCCACGTAGCATCTCAGCT

GCGGTTCTTGCGCGACGCTCCCCGGTTCTCGCTACCTCGCAGGGGTCGGAGTCCCGCGGCCTGCGCAGCCCTGCTCTCAG - UNI23085 - TATTCC

GGCTGACAGGAAGGAAGAAGGGCACGACCTGAAGCTGGCGAGTTGCACTCTGTTGGTGTCCTTGTGGCCAGTCCCTCCTTCAGGGGAAGCTGGAGAAAGC

AGACTGAAATCCCGGGTTCTGCTG GGCCACTGCCGGTGGAATGGCCAGCCTGCAGGAGGCCAATGGAAGCACAGCGTGGCCACCGCCCACAGCATCCAA

TATCAGTGAGCCCCACCAGTGCCTGCTGCTGCTATATGAGGATATTGGCTCCTCCAG GGTCCGGTACTGGGACCTCCTGCTGCTCATTCCCAATGTGCT

CTTCTTCATCTTCCTGCTCTGGAAGCTTCCCTTAGCTCGGGCCAAGATCCGTGTCACCTCCAGCCCCATTTTTATCACCTTCTACATCCTG GTGTTTGT

GGTAGCCCTGGTAGGCATTGCCAGGGCTGTGGTTTCTATGACAGTCAGCGCCTCTGATGCTGCGACAGTTGCTGACAAG ATCCTGTGGGAAATCACCCG

CTTCTTCCTGCTGGCCATTGAGCTGAGTGTGATCATCCTGGGTCTTGCCTTTG GTCACCTAGAGAGCAAGTCCAGCATCAAGCGGGTGCTGGCTATCAC

CACAGTATTGTCTCTGGCCTACTCAGTCACCCAG GGGACCTTGGAGATCCTGTACCCTGACTCCCATCTTTCAGCTGAGGATTTCAACATCTATGGCCA

TGGTGGCCGGCAGTTCTGGCTCGTCAGCTCTTGCTTTTTCTTCCTG GTCTACTCACTGGTGGTAATTCTCCCCAAGACCCCACTGAAGGAGCGTGTATC

CCTGCCCT CACGGAGGAGTTTCTACGTGTATGCAGGCATCCTGGCCACACTCAACCTGCTGCAGGGTTTGGGGAGTGCTCTGCTCTGCGCTAACATCAT

TGTGGGGCTCTG CTGTGTAGATGCCACCACCTTCCTGTACTTCAGCTTCTTTGCACCACTCATCTATGTGGCCTTCCTCCGTGGCTTCTTTGG CTCTG

AACCCAAGATCCTTTTCTCTTACAAATGCCAAGTGGACGAGGCTGAAGAGCCAGACATGCACCTGCCGCAGCCCTACGCTGTGGCCCGGCGCGAGGGCAT

AGAGTCTGCAGGACCTGCCTGCGCCTCTGCCGCCAACTACTCCAGCACACAGTTTGACTCTGCTGGGGTGGCCTACTTAGATGACATTGCCTCCATGCCC

TGCCACACGGGCAGCATCAACAGCACAGACAGCGAGCGCTGGAAAGCCATCAATGCCTGAGTGGGCACCTAAGCCTCGGGGAGGCCTGTAAAGACAGATG

GGAACTCGTGTGGATAGCCCTGGGCAGGTGTGCCTGCACCCCCAGCCTCTTCCTGATCTCCACCCCCATCCTCCTTTGCCTCCTGTGCTCTAGTGTGGGA

CCGCAGCCTTCCCAGCACTCCGTTCCTGCTGGTGTCCTGCCTGCCCAGCAACTTGTCCTTCTTCCATTGCTCTCGACCTCTTGGCCACAAGGCTGCAGTG

TATATATTTTCTTGATCTATTTTTTAATAAAAATAAAAAGAGTAGTAGGTGTG
Translation
 - UNI23085 -  MASLQEANGSTAWPPPTASNISEPHQCLLLLYEDIGSSR RVRYWDLLLLIPNVLFFIFLLWKLPLARAKIRVTSSPIFITFYIL

 VFVVALVGIARAVVSMTVSASDAATVADK ILWEITRFFLLAIELSVIILGLAFG GHLESKSSIKRVLAITTVLSLAYSVTQ GTLEILYPDSHLSAE

DFNIYGHGGRQFWLVSSCFFFL VYSLVVILPKTPLKERVSLPS SRRSFYVYAGILATLNLLQGLGSALLCANIIVGLC CCVDATTFLYFSFFAPLIY

VAFLRGFFG GSEPKILFSYKCQVDEAEEPDMHLPQPYAVARREGIESAGPACASAANYSSTQFDSAGVAYLDDIASMPCHTGSINSTDSERWKAINA

For any suggestions or comments, please send an email to unitrap@crg.es