Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002885 (Cd97)
Chromosomal location
Chr 8: 86247271 - 86265068 (-)
Description
CD97 antigen Gene [Source:MGI (curated);Acc:Cd97-001]
RefSeq_dna
NM_011925 
RefSeq_peptide
NP_036055.1 
UniGene
Mm.334648 
MGI
MGI:1347095 
Uniprot/SWISSPROT
Q9Z0M6 
Uniprot/SPTREMBL
Q4FJS6 Q9DC42 
Human Ortholog
ENSG00000123146 (CD97)
Omim not available
UniTrap UNI6526
Vector Insertion
Chr 8: 86258252 - 86265005
Public Clones (sanger) CSC183 (baygenomics) E025D11 (ggtc) D117A10 (ggtc) PST14717-NR (escells)
PST13882-NR (escells) IST11631G1 (tigm) IST12070F5 (tigm) IST11605G5 (tigm)
IST14889D6 (tigm) IST14189G2 (tigm) IST14782A8 (tigm) IST12866F12 (tigm)
Private Clones OST308301 (lexicon) OST208347 (lexicon) OST51229 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17741
Vector Insertion
Chr 8: 86258025 - 86258194
Public Clones CMHD-GT_403A1-3 (cmhd)
Private Clones OST437161 (lexicon) OST200150 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25172
Vector Insertion
Chr 8: 86257466 - 86257907
Public Clones not available
Private Clones OST193046 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11108
Vector Insertion
Chr 8: 86253034 - 86253155
Public Clones G052D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000002964
Sequence
CCCAGACGCTGTCCGTTCCGTGCCGCGCCACCATGAGGGGCGTCAGATGCCCCGGCCTGCTTG - UNI6526 - TGGTGTGCATTTTACTGAGTCTCT

CAGGAGCTGGAACCCAGAAGGCAGAGAGTAAGA - UNI17741 - ACTGTGCCAAGTGGTGCCCTATCAACTCAAAATGTGTCAGTAACAGAAGCTGT

GTCTGCAAGCCCGGCTTCAGCTCGGAGAAGGAATTGATCACTAACCCTGCAGAGAGCTGTGAAG - UNI25172 - ACATCAACGAGTGTTTACTACC

TGGATTTTCCTGTGGAGACTTTGCCATGTGTAAGAACTCAGAGGGGAGTTACACCTGCGTCTGTAACCTGGGATATAAGCTCCTTTCTGGTGCAGAATCT

TTTGTTAACGAGAGTGAGAATACATGTCAAG ATGTGGATGAGTGCAGCTCTGGGCAGCATCAATGTCACAATTCCACCGTCTGCAAAAACACCGTAGGC

TCCTACAAGTGCCACTGCCGTCCAGGTTGGAAGCCAACTTCTGGGTCCCTCCGTGGTCCAGACACCATATGCCAAG AGCCACCGTTCCCTACTTGGACA

CTGCTGCCCACAGCCCACAGTCAG - UNI11108 - ACTCTCTTGAGATTCTCTGTTGAAGTCCAGAATCTGCTCCGTGACTTCAATCCAGCCACGGT

CAACTACACCATCCAG AAACTCATCGAGGCTGTGGACAAGCTGCTGGAAGACCCCATGGAGACTGAAACCCAACAAGTAGCTGCCCAGTTGCTCTCGAA

CCTGGAACAAAGCCTTCGGACCTTGGCTCAGTTTTTACCCAAAGGCCCCTTCACCTACACGTCCCCTTCAAATACTG AACTGTCCCTGATGGTGAAGGA

GCAAGACAACAAAGATGTTACCACAGTGCACCACGGCCAAACTTGGATGGAGCTGGACTGGGCTGTGACAGCTGGAGCCAAAATCTCAGAAAATG GCTC

CTCGGTGGCAGGCATCCTGTCCAGCCCAAACATGGAAAAGCTGCTGGGCAACACCCCGCTGAACTTGGAGCAGAGAAGGGCCTCCTTGGAGGACTTCTAT

GGAAGCCCGATTCCGAGTGTCTCACTTAAGCTTCTCTCAAACATCAATTCTGTCTTCCTGACCAACACGAACACTGAAAAGCTCGCCTCGAATGTCACGT

TCAAGTTCGACTTTACTTCT GTGGAGTCAATTGAGCCACGTCATGAGCTGATATGTGCCTTCTGGAAAGCCCACAACGGGAATGGGTACTGGGACACCG

ACGGCTGCTCAATGAATGGCACTGGCTTCTGCCACTGCAACCACCTGACCAGCTTTGCCATCCTAATGGCTCAGTACCATGTGCAG GACCCAAGGCTGG

AATTGATCACCAAGGTGGGGCTGTTGTTGTCCCTGATCTGCCTGCTGCTGTGCATCCTGACCTTCCTGCTGGTGAAGCCCATCCAGAGCTCTCGAACCAT

GGTGCACCTGCACCTGTGCATCTGCCTCTTCCTGGGCTCAATCATATTCCTGGTCGGCGTGGAGAATGAAGGGGGTGAG GTGGGCCTGCGCTGCCGCCT

GGTGGCCGTGATGCTGCATTTCTGCTTCCTGGCCGCCTTCTGCTGGATGGCACTGGAGGGCGTGGAGCTCTACTTCCTGGTGGTGCGTGTGTTCCAGGGC

CAAGGCCTGAGTACATGGCAACGCTGCCTGATTGGCTACGGGGTGCCCCTCCTCATCGTGGCCATCTCAATGGCAGTTGTCAAAATGGATGGCTATGGGC

ATGCAACATA CTGCTGGCTGGACTTTAGGAAGCAGGGCTTTCTCTGGAGCTTTTCGGGACCCGTGGCCTTCATCATTTTC TGCAATGCTGCCATTTTC

GTGATCACTGTCTGGAAGCTCACAAAGAAGTTTTCTGAAATCAACCCAAACATGAAGAAGTTAAGGAAGGCGAG GGTGCTGACCATCACCTCCATCGCC

CAGCTCCTTGTGCTGGGCTGCACCTGGGGCTTCGGCCTGTTCCTCTTCAACCCCCATAGCACATGGCTATCCTACATCTTTACCCTGCTCAACTGCCTGC

AGGGCCTATTCCTCTATGTGATGCTCTGCCTGCTCAACAAAAAG GTGAGGGAAGAGTACTGGAAATGGGCCTGCATGGTCACTGGGAGCAAGTACACAG

AGTTCAACTCTTCCACAACAGGCACTGGCACCAGCCAAACACGG GCTCTCAGGTCCTCAGAATCAGGGATGTGAAGGCGAGTTCCATGAAGGACAGCAG

CACATACTCACGGCTGTCATTCTGCCTTCTGTTCCTGCCACCTTTCGGCCTTTGACCCCACTTCATATAAAGAAGGGATGCAAACCCAGCAATGAGCCCT

GCCACGGGGCAAGGGGTCGCTGGTCCTGCTTCTGGTTGTCTCTGCCTCACCACAGCTACTGCCTACCAGAGAAACAGAATGCAGCCAGCCCAGACCTGCA

GCCCACTGCCTGGTACACGAGGCAGGCAGTCCTAGGACAAAGGGAAGAGCCCTTGAGACCTGGGCTCTTTGCCAGGGTGCTGGGTTCAGTTTCCTTAAGC

TAAGACTGTGGATGCCACGTCAGCCACTGAAGCCCGCCTGCTGCTGAGGCTCACGGTACAGAGGCCTCGCTGCTCCACATCCAGGGCAGAAGGTCTCACA

GCTAAAGACTAGGTTTTGTAATTTTTTTAACCTGTAAACCTTTCAATGTTGACACACAAAATTAAATATCATATTG
Translation
MRGVRCPGLLV - UNI6526 - VVCILLSLSGAGTQKAESKN - UNI17741 - NCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCED -

 UNI25172 - DINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQD DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKP

TSGSLRGPDTICQE EPPFPTWTLLPTAHSQ - UNI11108 - TLLRFSVEVQNLLRDFNPATVNYTIQ KLIEAVDKLLEDPMETETQQVAAQLLSN

LEQSLRTLAQFLPKGPFTYTSPSNTE ELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISENG GSSVAGILSSPNMEKLLGNTPLNLEQRRASLE

DFYGSPIPSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTS VESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFAILMAQYHVQ 

DPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGE VGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVV

RVFQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHATY YCWLDFRKQGFLWSFSGPVAFIIF CNAAIFVITVWKLTKKFSEINPNMKKLRKAR 

RVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLLNKK VREEYWKWACMVTGSKYTEFNSSTTGTGTSQTR ALRSSESG

M
Transcript ENSMUST00000109802
Sequence
CCCAGACGCTGTCCGTTCCGTGCCGCGCCACCATGAGGGGCGTCAGATGCCCCGGCCTGCTTG - UNI6526 - TGGTGTGCATTTTACTGAGTCTCT

CAGGAGCTGGAACCCAGAAGGCAGAGAGTAAGA - UNI17741 - ACTGTGCCAAGTGGTGCCCTATCAACTCAAAATGTGTCAGTAACAGAAGCTGT

GTCTGCAAGCCCGGCTTCAGCTCGGAGAAGGAATTGATCACTAACCCTGCAGAGAGCTGTGAAG - UNI25172 - ACATCAACGAGTGTTTACTACC

TGGATTTTCCTGTGGAGACTTTGCCATGTGTAAGAACTCAGAGGGGAGTTACACCTGCGTCTGTAACCTGGGATATAAGCTCCTTTCTGGTGCAGAATCT

TTTGTTAACGAGAGTGAGAATACATGTCAAG ATGTGAATGAGTGCATCTCCGGGCAAAACCATTGCCACCAATCCACCCACTGCATCAACAAATTGGGT

GGCTATTCTTGCATCTGTCGTCAAGGCTGGAAACCTGTTCCTGGATCCCCCAATGGCCCTGTCAGCACAGTGTGCGAAG ATGTGGATGAGTGCAGCTCT

GGGCAGCATCAATGTCACAATTCCACCGTCTGCAAAAACACCGTAGGCTCCTACAAGTGCCACTGCCGTCCAGGTTGGAAGCCAACTTCTGGGTCCCTCC

GTGGTCCAGACACCATATGCCAAG AGCCACCGTTCCCTACTTGGACACTGCTGCCCACAGCCCACAGTCAG - UNI11108 - ACTCTCTTGAGATT

CTCTGTTGAAGTCCAGAATCTGCTCCGTGACTTCAATCCAGCCACGGTCAACTACACCATCCAG AAACTCATCGAGGCTGTGGACAAGCTGCTGGAAGA

CCCCATGGAGACTGAAACCCAACAAGTAGCTGCCCAGTTGCTCTCGAACCTGGAACAAAGCCTTCGGACCTTGGCTCAGTTTTTACCCAAAGGCCCCTTC

ACCTACACGTCCCCTTCAAATACTG AACTGTCCCTGATGGTGAAGGAGCAAGACAACAAAGATGTTACCACAGTGCACCACGGCCAAACTTGGATGGAG

CTGGACTGGGCTGTGACAGCTGGAGCCAAAATCTCAGAAAATG GCTCCTCGGTGGCAGGCATCCTGTCCAGCCCAAACATGGAAAAGCTGCTGGGCAAC

ACCCCGCTGAACTTGGAGCAGAGAAGGGCCTCCTTGGAGGACTTCTATGGAAGCCCGATTCCGAGTGTCTCACTTAAGCTTCTCTCAAACATCAATTCTG

TCTTCCTGACCAACACGAACACTGAAAAGCTCGCCTCGAATGTCACGTTCAAGTTCGACTTTACTTCT GTGGAGTCAATTGAGCCACGTCATGAGCTGA

TATGTGCCTTCTGGAAAGCCCACAACGGGAATGGGTACTGGGACACCGACGGCTGCTCAATGAATGGCACTGGCTTCTGCCACTGCAACCACCTGACCAG

CTTTGCCATCCTAATGGCTCAGTACCATGTGCAG GACCCAAGGCTGGAATTGATCACCAAGGTGGGGCTGTTGTTGTCCCTGATCTGCCTGCTGCTGTG

CATCCTGACCTTCCTGCTGGTGAAGCCCATCCAGAGCTCTCGAACCATGGTGCACCTGCACCTGTGCATCTGCCTCTTCCTGGGCTCAATCATATTCCTG

GTCGGCGTGGAGAATGAAGGGGGTGAG GTGGGCCTGCGCTGCCGCCTGGTGGCCGTGATGCTGCATTTCTGCTTCCTGGCCGCCTTCTGCTGGATGGCA

CTGGAGGGCGTGGAGCTCTACTTCCTGGTGGTGCGTGTGTTCCAGGGCCAAGGCCTGAGTACATGGCAACGCTGCCTGATTGGCTACGGGGTGCCCCTCC

TCATCGTGGCCATCTCAATGGCAGTTGTCAAAATGGATGGCTATGGGCATGCAACATA CTGCTGGCTGGACTTTAGGAAGCAGGGCTTTCTCTGGAGCT

TTTCGGGACCCGTGGCCTTCATCATTTTC TGCAATGCTGCCATTTTCGTGATCACTGTCTGGAAGCTCACAAAGAAGTTTTCTGAAATCAACCCAAACA

TGAAGAAGTTAAGGAAGGCGAG GGTGCTGACCATCACCTCCATCGCCCAGCTCCTTGTGCTGGGCTGCACCTGGGGCTTCGGCCTGTTCCTCTTCAACC

CCCATAGCACATGGCTATCCTACATCTTTACCCTGCTCAACTGCCTGCAGGGCCTATTCCTCTATGTGATGCTCTGCCTGCTCAACAAAAAG GTGAGGG

AAGAGTACTGGAAATGGGCCTGCATGGTCACTGGGAGCAAGTACACAGAGTTCAACTCTTCCACAACAGGCACTGGCACCAGCCAAACACGG GCTCTCA

GGTCCTCAGAATCAGGGATGTGAAGGCGAGTTCCATGAAGGACAGCAGCACATACTCACGGCTGTCATTCTGCCTTCTGTTCCTGCCACCTTTCGGCCTT

TGACCCCACTTCATATAAAGAAGGGATGCAAACCCAGCAATGAGCCCTGCCACGGGGCAAGGGGTCGCTGGTCCTGCTTCTGGTTGTCTCTGCCTCACCA

CAGCTACTGCCTACCAGAGAAACAGAATGCAGCCAGCCCAGACCTGCAGCCCACTGCCTGGTACACGAGGCAGGCAGTCCTAGGACAAAGGGAAGAGCCC

TTGAGACCTGGGCTCTTTGCCAGGGTGCTGGGTTCAGTTTCCTTAAGCTAAGACTGTGGATGCCACGTCAGCCACTGAAGCCCGCCTGCTGCTGAGGCTC

ACGGTACAGAGGCCTCGCTGCTCCACATCCAGGGCAGAAGGTCTCACAGCTAAAGACTAGGTTTTGTAATTTTTTTAACCTGTAAACCTTTCAATGTTGA

CACACAAAATTAAATATCATATTG
Translation
MRGVRCPGLLV - UNI6526 - VVCILLSLSGAGTQKAESKN - UNI17741 - NCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCED -

 UNI25172 - DINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQD DVNECISGQNHCHQSTHCINKLGGYSCICRQGWKP

VPGSPNGPVSTVCED DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQE EPPFPTWTLLPTAHSQ - UNI11108 - TLLR

FSVEVQNLLRDFNPATVNYTIQ KLIEAVDKLLEDPMETETQQVAAQLLSNLEQSLRTLAQFLPKGPFTYTSPSNTE ELSLMVKEQDNKDVTTVHHGQT

WMELDWAVTAGAKISENG GSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTS VESIE

PRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFAILMAQYHVQ DPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFL

GSIIFLVGVENEGGE VGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHATY YCWLDF

RKQGFLWSFSGPVAFIIF CNAAIFVITVWKLTKKFSEINPNMKKLRKAR RVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYV

MLCLLNKK VREEYWKWACMVTGSKYTEFNSSTTGTGTSQTR ALRSSESGM
Transcript ENSMUST00000075843
Sequence
CCCAGACGCTGTCCGTTCCGTGCCGCGCCACCATGAGGGGCGTCAGATGCCCCGGCCTGCTTG - UNI6526 - TGGTGTGCATTTTACTGAGTCTCT

CAGGAGCTGGAACCCAGAAGGCAGAGAGTAAGA - UNI17741 - ACTGTGCCAAGTGGTGCCCTATCAACTCAAAATGTGTCAGTAACAGAAGCTGT

GTCTGCAAGCCCGGCTTCAGCTCGGAGAAGGAATTGATCACTAACCCTGCAGAGAGCTGTGAAG - UNI25172 - ACATCAACGAGTGTTTACTACC

TGGATTTTCCTGTGGAGACTTTGCCATGTGTAAGAACTCAGAGGGGAGTTACACCTGCGTCTGTAACCTGGGATATAAGCTCCTTTCTGGTGCAGAATCT

TTTGTTAACGAGAGTGAGAATACATGTCAAG CATCAGTGAACACTGGGATGACACCTGTGCCCTCCAGGATCCACACAGTTACTACTGCGCCTGGAAAT

CTCCCCGAGCAGACAACTACAGTGCACCAGACACAGATGGGAGACTCAGAAGAGAGGACACCCAAGG ATGTGAATGAGTGCATCTCCGGGCAAAACCAT

TGCCACCAATCCACCCACTGCATCAACAAATTGGGTGGCTATTCTTGCATCTGTCGTCAAGGCTGGAAACCTGTTCCTGGATCCCCCAATGGCCCTGTCA

GCACAGTGTGCGAAG ATGTGGATGAGTGCAGCTCTGGGCAGCATCAATGTCACAATTCCACCGTCTGCAAAAACACCGTAGGCTCCTACAAGTGCCACT

GCCGTCCAGGTTGGAAGCCAACTTCTGGGTCCCTCCGTGGTCCAGACACCATATGCCAAG AGCCACCGTTCCCTACTTGGACACTGCTGCCCACAGCCC

ACAGTCAG - UNI11108 - ACTCTCTTGAGATTCTCTGTTGAAGTCCAGAATCTGCTCCGTGACTTCAATCCAGCCACGGTCAACTACACCATCCAG

 AAACTCATCGAGGCTGTGGACAAGCTGCTGGAAGACCCCATGGAGACTGAAACCCAACAAGTAGCTGCCCAGTTGCTCTCGAACCTGGAACAAAGCCTT

CGGACCTTGGCTCAGTTTTTACCCAAAGGCCCCTTCACCTACACGTCCCCTTCAAATACTG AACTGTCCCTGATGGTGAAGGAGCAAGACAACAAAGAT

GTTACCACAGTGCACCACGGCCAAACTTGGATGGAGCTGGACTGGGCTGTGACAGCTGGAGCCAAAATCTCAGAAAATG GCTCCTCGGTGGCAGGCATC

CTGTCCAGCCCAAACATGGAAAAGCTGCTGGGCAACACCCCGCTGAACTTGGAGCAGAGAAGGGCCTCCTTGGAGGACTTCTATGGAAGCCCGATTCCGA

GTGTCTCACTTAAGCTTCTCTCAAACATCAATTCTGTCTTCCTGACCAACACGAACACTGAAAAGCTCGCCTCGAATGTCACGTTCAAGTTCGACTTTAC

TTCT GTGGAGTCAATTGAGCCACGTCATGAGCTGATATGTGCCTTCTGGAAAGCCCACAACGGGAATGGGTACTGGGACACCGACGGCTGCTCAATGAA

TGGCACTGGCTTCTGCCACTGCAACCACCTGACCAGCTTTGCCATCCTAATGGCTCAGTACCATGTGCAG GACCCAAGGCTGGAATTGATCACCAAGGT

GGGGCTGTTGTTGTCCCTGATCTGCCTGCTGCTGTGCATCCTGACCTTCCTGCTGGTGAAGCCCATCCAGAGCTCTCGAACCATGGTGCACCTGCACCTG

TGCATCTGCCTCTTCCTGGGCTCAATCATATTCCTGGTCGGCGTGGAGAATGAAGGGGGTGAG GTGGGCCTGCGCTGCCGCCTGGTGGCCGTGATGCTG

CATTTCTGCTTCCTGGCCGCCTTCTGCTGGATGGCACTGGAGGGCGTGGAGCTCTACTTCCTGGTGGTGCGTGTGTTCCAGGGCCAAGGCCTGAGTACAT

GGCAACGCTGCCTGATTGGCTACGGGGTGCCCCTCCTCATCGTGGCCATCTCAATGGCAGTTGTCAAAATGGATGGCTATGGGCATGCAACATA CTGCT

GGCTGGACTTTAGGAAGCAGGGCTTTCTCTGGAGCTTTTCGGGACCCGTGGCCTTCATCATTTTC TGCAATGCTGCCATTTTCGTGATCACTGTCTGGA

AGCTCACAAAGAAGTTTTCTGAAATCAACCCAAACATGAAGAAGTTAAGGAAGGCGAG GGTGCTGACCATCACCTCCATCGCCCAGCTCCTTGTGCTGG

GCTGCACCTGGGGCTTCGGCCTGTTCCTCTTCAACCCCCATAGCACATGGCTATCCTACATCTTTACCCTGCTCAACTGCCTGCAGGGCCTATTCCTCTA

TGTGATGCTCTGCCTGCTCAACAAAAAG GTGAGGGAAGAGTACTGGAAATGGGCCTGCATGGTCACTGGGAGCAAGTACACAGAGTTCAACTCTTCCAC

AACAGGCACTGGCACCAGCCAAACACGG GCTCTCAGGTCCTCAGAATCAGGGATGTGAAGGCGAGTTCCATGAAGGACAGCAGCACATACTCACGGCTG

TCATTCTGCCTTCTGTTCCTGCCACCTTTCGGCCTTTGACCCCACTTCATATAAAGAAGGGATGCAAACCCAGCAATGAGCCCTGCCACGGGGCAAGGGG

TCGCTGGTCCTGCTTCTGGTTGTCTCTGCCTCACCACAGCTACTGCCTACCAGAGAAACAGAATGCAGCCAGCCCAGACCTGCAGCCCACTGCCTGGTAC

ACGAGGCAGGCAGTCCTAGGACAAAGGGAAGAGCCCTTGAGACCTGGGCTCTTTGCCAGGGTGCTGGGTTCAGTTTCCTTAAGCTAAGACTGTGGATGCC

ACGTCAGCCACTGAAGCCCGCCTGCTGCTGAGGCTCACGGTACAGAGGCCTCGCTGCTCCACATCCAGGGCAGAAGGTCTCACAGCTAAAGACTAGGTTT

TGTAATTTTTTTAACCTGTAAACCTTTCAATGTTGACACACAAAATTAAATATCATATTG
Translation
MRGVRCPGLLV - UNI6526 - VVCILLSLSGAGTQKAESKN - UNI17741 - NCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCED -

 UNI25172 - DINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQA ASVNTGMTPVPSRIHTVTTAPGNLPEQTTTVHQTQ

MGDSEERTPKD DVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCED DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTS

GSLRGPDTICQE EPPFPTWTLLPTAHSQ - UNI11108 - TLLRFSVEVQNLLRDFNPATVNYTIQ KLIEAVDKLLEDPMETETQQVAAQLLSNLE

QSLRTLAQFLPKGPFTYTSPSNTE ELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISENG GSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDF

YGSPIPSVSLKLLSNINSVFLTNTNTEKLASNVTFKFDFTS VESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFAILMAQYHVQ DP

RLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGE VGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRV

FQGQGLSTWQRCLIGYGVPLLIVAISMAVVKMDGYGHATY YCWLDFRKQGFLWSFSGPVAFIIF CNAAIFVITVWKLTKKFSEINPNMKKLRKAR RV

LTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLLNKK VREEYWKWACMVTGSKYTEFNSSTTGTGTSQTR ALRSSESGM

For any suggestions or comments, please send an email to unitrap@crg.es