Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002948 (Map2k7)
Chromosomal location
Chr 8: 4238761 - 4251423 (+)
Description
mitogen-activated protein kinase kinase 7 Gene [Source:MGI (curated);Acc:Map2k7-003]
RefSeq_dna
NM_011944 NM_001042557 
RefSeq_peptide
NP_036074.2 NP_001036022.1 
UniGene
Mm.405794 Mm.3906 
MGI
MGI:1346871 
Uniprot/SWISSPROT
Q8CE90 
Human Ortholog
ENSG00000076984 (MAP2K7)
Omim not available
UniTrap UNI12646
Vector Insertion
Chr 8: 4238864 - 4239034
Public Clones A027F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110993
Sequence
AGAGGGCTGGGTACAGCCCAGCCAGGTGCTCGCTGCCGGTCTGGAGCACTCGAACCTGGACAGGCCGCCATGGTGGGCACTGCGCTCCTGCTCCTGGCCC

TGCTCCCTGGGACCTCCAGTAAGCACGGTACACCACGTG CACCTCTGTTACCTGGGGCGCCTGGCCCCTGGCTGCGCAGACCCCTTTTCAGTCTGGAGT

TATCAGATGCAGAGGACGCGTTCCCTCGCCGCGCAGGGCCACTGGAGGTTCCGGCGGACAGCCATGTGTTTGTGCAG GCGGCCCTGGCCCGTCCTTCAC

CGAGATGGGGCCTAGCCCTTCACCGATGCTCAGTAACACCTTCTTCACGCCCGACCCTGGGGCCTGCCCTGGTGCTTCTACGTGGGGGCTGCCCCGCCGA

CGACTCTGTCAGCTTCTCACCACCTCCACGCCCGGATGCTGCTAGCGTCTCACGCTTCAGCTTTCGCCTGCGTCCGGTATTCAATGCCTCAGTACAGTTC

TTGCACTGCCAGATCAGCCGTTGCCGCCGTCGCAGCAGTCACCACCGCCGAGCTGTCCGCCTGACACCAGTGCCTTTGACCCCACCAGCACCATTGCGG 

TGTCTGCCTCAGGATGAGGCATGTGCGGGCAGCAGCTTGAGCCTTGGTACCGACAGCCCCCACCTGCACATGCTGACACAGCCCATCGTGGTCACAATAC

CTCGTCCGTCCCCTA GGCCATCCAAGAGTCTCCCAGGCAGGTCGGTACACCCGGAGCCACCCGCTCCAGCCCCTGCAGCACTGGAGCCTGCACCGGTGG

TGGCATTGGTGTTGGCGGCCTTCGTGCTGGGTGCTGCGCTGGCCGCTGGGCTTGGTCTCGTCTGCGCACACTCAG CACCCCCACCCCCAGGCCCGCCTC

CTAGAGCTTCTCTCAGCGGCCCCCAGCTCCAGAGACCCCCAGTAGGCAG AGATGGCACCACCCAGTGAGGTCCTGAGATCCACTCAGCCGTGGTTTACC

GTTCAGAAGGCCTCCTGCGTGTCTTCTCTCCCCTCTCCCTGTCCTCACTCCCCTGTTCAAAATAAATTGGTGACCTGCTAA
Translation
MVGTALLLLALLPGTSSKHGTPRA APLLPGAPGPWLRRPLFSLELSDAEDAFPRRAGPLEVPADSHVFVQ AALARPSPRWGLALHRCSVTPSSRPTLG

PALVLLRGGCPADDSVSFSPPPRPDAASVSRFSFRLRPVFNASVQFLHCQISRCRRRSSHHRRAVRLTPVPLTPPAPLR CLPQDEACAGSSLSLGTDSP

HLHMLTQPIVVTIPRPSPR RPSKSLPGRSVHPEPPAPAPAALEPAPVVALVLAAFVLGAALAAGLGLVCAHSA APPPPGPPPRASLSGPQLQRPPVGR

 RDGTTQ
Transcript ENSMUST00000110994
Sequence
GGAAAGGCAGCCTCCTGTAGGTGAAAATTCTGTTCACTACCTGGCCACCTGGCCTGACTGACCTTCACAGCTTGATCATCTTCCTGAAGAGGCATTCAGG

ATTCCCTCCATCCCTACCCCTTCTGGACAAAGTCTTCCACGTTTCCTTCCTGGGAGTTTCTTCCAGGAACTGGAGATACCCAGAG CCCTGCAACTCCCA

CTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCACCCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAA

CCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAGGAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGT

TATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACCTGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCA

TTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATTTTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACA

TCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATGGAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGG

GCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCACTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCA

AACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTGGCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGC

TGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCAAGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTC

ACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACTTTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCC

TGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTACTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAAC

ACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTAAGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCT

GAGTCAGCACCATCTGCCCTTCTTCAGGTAGCCTCATGGCAGCGGCCAGCCCCGCAGGGGCCCCGGGCCACGGCCACCGACCCCCCCCCCAACCTGGCCA

ACCCAGCTGCCCATCAGGGGACCTGGGACCTGGACGACTGCCAAGGACTGAGGACAGAAAGTAGGGGGTTCCCATCCAGCTCTGACTCCCTGCCTACCAG

CTGTGGACAAAAGGGCATGCTGGTTCCTAATCCCTCCCACTCTGGGGTCAGCCAGCAGTGTGAGCCCCATCCCACCCCGACAGACACTGTGAACGGAAGA

CAGCAGGCCATGAGCAGACTCGCTATTTATTCAATCATAACCTCTGGGCTGGGGTAACCCCCAGGGGCAGAGAGAAAGCCCCTTGTCCCCATCCCCCCAA

ACTCCCAGTGTCTGTCCCCTCCACCTTCTCTCGCACACATGCTTGCTCTACGTCTTTCCTTCTGTCCCCTCCCTCTCTACCACTGTCCCTTTCTGGTTCC

CCTGTCTCCCTCCCAGCCTCTGAAGCCTGGGTGCCGCCACTCTACCCTCAGTGGAAGGAAGCCCCAGGTTCATCTAGGCTTCCTTAAGTCTTTGTCCTAG

GATGGCTTTGTGGGCATTGTGACTGCAGCCAAATGGTTGCTGTCTCTGTGTCTGTCTGTCTCTCTTTGATCTCAGGGGGTCCTTTTGGAGTTTATTGTAT

TTTATTGTACTTGGTGGGGGTGTGTTGGGGGGGGGGTGTCCTCATGGGGTCGGTACCTTCAGAAAATTTTACCAAAGTAATGTTTAGCTGCTTGTGGTGG

CCCCCTCTCCTCCATTGCCTCAGGCATTGGGGGTTGGACTGCTTGCTGCTCCTTGTCATTTCTGGCCTAGGAGAGGCCAGGCTCCATGGGGGACCCTCAC

ATGGGACTGGGAGCTGCTGACAGTTTGGGGTTGAGTAGAAGAGCTCAGGTGGCACAGAGGGAGACCAGGGGCCTCAGCCACACGATGGCCTTCAGGGAAG

GTGTATGAGGGATGCAGTAGAGAGTAGCAGGTAGCAGGGAGGGACTGTTGGGAACAGTGACAGGAGGGAATCCTGCCAAGGGGCAGGAGGGGTCCCGAGA

AGTCAGGGATTAGGAGTGAAGGGAGTAGATGTGGAGGTCCGAGCATGTGAATCAGGGACGAGACGGACAGGCGTGAATGCAGGGGAGGCCAGAGTATTGG

GATGCGACGCGACTTACTCCCAACATGCCCCTGAGCATGCTTTAGCTCACCTAGAGCTGACCAGCTCCAACCCAACCTGTGGCCTGGACTGGGCCAGGTG

CCTGTCCCATTGTCCTGCAGTTTCGAGGACAGAGTGGGGTATGTTTCCTTTTTGTTGGTGATGCATGCAGTTCAAGTGGACAAGAGAACAATATAACAAA

ACAAAAAAATTTACAACCACAAATCCCAGCACCAAAGTTGAGAAACCTTGCTGGAAGTAGCTGATGCAACCATACGTAGGCTTAGGTGACACTGTGGCTC

TTAACTGTCCTGTTGACGCCTCTTCATCCTATTCTCACAATGCCGCATGCTTAAATCGTAATAGAAGTCATCTTCTATGCCCGGGTAGGGTAGGGCACCC

TCTCTCCTTATCTCCTGTGTTGGGGAGGCGGAATGAAGTAGGGAGAGAGTAGCAAGCCCGGCCCCACCCTTACCATTCTGAGGCTGGCCGCAGCATGGCT

AGCCTTTGTGTGTACTTAGGTCACATGGCTGGTCCCAGGGCCAGCACAGGCCCAAGACTGGGCCTGATGGTTTTATTTTTATTTAACTTTATTTTCTGTG

TGTTGTCTGTCTGTCTGTCTGTCTGTGTTGTCTTTGTCTACTGCCCTCTAATGTTAAGTGGGAGTCTGGAGGAGTCTCCCACTTCCCCACCTTCTCCCAA

GTCCTTCCCTCTGTCACCAGCCATCCCTCAGGCCCAGGCAGAGTGGGTCTCGGGCAGGTAGGGACCTGGAGTGGCCTGGTCCCACCCTCTGACCTCCTCC

TCAGGCCACCAGTGTTGCCCTCTTCCCTTTTTAAAACAAAATACCCTTGTTTGTAAATCCTTAGACGCTTGAGAATAAAACCCTTCCCTTTTCTTCCG
Translation
 MLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRILMDLD

VVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISG

RLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC CLT

KDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
Transcript ENSMUST00000110995
Sequence
GGAAAGGCAGCCTCCTGTAGGTGAAAATTCTGTTCACTACCTGGCCACCTGGCCTGACTGACCTTCACAGCTTGATCATCTTCCTGAAGAGGCATTCAGG

ATTCCCTCCATCCCTACCCCTTCTGGACAAAGTCTTCCACGTTTCCTTCCTGGGAGTTTCTTCCAGGAACTGGAGATACCCAGAG CCCTGCAACTCCCA

CTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCACCCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAA

CCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAGGAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGT

TATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACCTGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCA

TTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATTTTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACA

TCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATGGAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGG

GCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCACTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCA

AACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTGGCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGC

TGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCAAGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTC

ACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACTTTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCC

TGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTACTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAAC

ACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTAAGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCT

GAGTCAGCACCATCTGCCCTTCTTCAG TGGGAGTCTGGAGGAGTCTCCCACTTCCCCACCTTCTCCCAAGTCCTTCCCTCTGTCACCAGCCATCCCTCA

GGCCCAGGCAGAGTGGGTCTCGGGCAGGTAGGGACCTGGAGTGGCCTGGTCCCACCCTCTGACCTCCTCCTCAGGCCACCAGTGTTGCCCTCTTCCCTTT

TTAAAACAAAATACCCTTGTTTGTAAATCCTTAGACGCTTGAGAATAAAACCCTTCCCTTTTCTTCCGA
Translation
 MLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRILMDLD

VVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISG

RLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC CLT

KDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFS SGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
Transcript ENSMUST00000110996
Sequence
ATGCTAACTCCTTTCATGCCCCTGGTTTTTAATTCCCCAGCCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCC

CACAGCACCCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGA

AGCTGCAGGAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCA

GTGGTACCTGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATA

AGCGCATTTTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTA

TTGCCATGGAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTG

TGAAAGCACTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTG

TGACTTTGGCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGA

TCCCACCAAGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAA

GACGGACTTTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGAC

TG CCTTACTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTC

CTGGTTTAAGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAGGTAGCCTCATGGCAGC
Translation
MLTPFMPLVFNSPALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGE

MGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMT

VA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQF

PYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC CLTKDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPF

FR
Transcript ENSMUST00000062686
Sequence
GCACGCGAGGCAGGGCGGGCACGCGCTGGGGTGGTCTAGGCAGGACGGCGGCTCGGCGGGGTCATCCGAGCGCAGGCGCAGTGCGGTGTTTGTCTACCCC

GGACTGACGGGTGGCCTGGCGGTGAGCGGCGGCAGCGGCGGCGGGGAAGATGGCGGCGTCCTCCCTGGAGCAGAAGCTGTCCCGCCTGGAAGCCAAGCTG

AAGCAGGAGAACCGTGAGGCCCGCAGGAGGATCGACCTCAACTTGGATATCAGCCCACAGCGGCCCAGGCCCA - UNI12646 - TTATTGTGATCAC

TCTAAGCCCTGCTCCTGCCCCGTCCCAGCGAGCAG CCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACA

GCACCCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCT

GCAGGAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGG

TACCTGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCG

CATTTTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGC

CATGGAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAA

AGCACTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGAC

TTTGGCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCC

ACCAAGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACG

GACTTTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG C

CTTACTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGG

TTTAAGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAGGTAGCCTCATGGCAGCGGCCAGC

CCCGCAGGGGCCCCGGGCCACGGCCACCGACCCCCCCCCCAACCTGGCCAACCCAGCTGCCCATCAGGGGACCTGGGACCTGGACGACTGCCAAGGACTG

AGGACAGAAAGTAGGGGGTTCCCATCCAGCTCTGACTCCCTGCCTACCAGCTGTGGACAAAAGGGCATGCTGGTTCCTAATCCCTCCCACTCTGGGGTCA

GCCAGCAGTGTGAGCCCCATCCCACCCCGACAGACACTGTGAACGGAAGACAGCAGGCCATGAGCAGACTCGCTATTTATTCAATCATAACCTCTGGGCT

GGGGTAACCCCCAGGGGCAGAGAGAAAGCCCCTTGTCCCCATCCCCCCAAACTCCCAGTGTCTGTCCCCTCCACCTTCTCTCGCACACATGCTTGCTCTA

CGTCTTTCCTTCTGTCCCCTCCCTCTCTACCACTGTCCCTTTCTGGTTCCCCTGTCTCCCTCCCAGCCTCTGAAGCCTGGGTGCCGCCACTCTACCCTCA

GTGGAAGGAAGCCCCAGGTTCATCTAGGCTTCCTTAAGTCTTTGTCCTAGGATGGCTTTGTGGGCATTGTGACTGCAGCCAAATGGTTGCTGTCTCTGTG

TCTGTCTGTCTCTCTTTGATCTCAGGGGGTCCTTTTGGAGTTTATTGTATTTTATTGTACTTGGTGGGGGTGTGTTGGGGGGGGGGTGTCCTCATGGGGT

CGGTACCTTCAGAAAATTTTACCAAAGTAATGTTTAGCTGCTTGTGGTGGCCCCCTCTCCTCCATTGCCTCAGGCATTGGGGGTTGGACTGCTTGCTGCT

CCTTGTCATTTCTGGCCTAGGAGAGGCCAGGCTCCATGGGGGACCCTCACATGGGACTGGGAGCTGCTGACAGTTTGGGGTTGAGTAGAAGAGCTCAGGT

GGCACAGAGGGAGACCAGGGGCCTCAGCCACACGATGGCCTTCAGGGAAGGTGTATGAGGGATGCAGTAGAGAGTAGCAGGTAGCAGGGAGGGACTGTTG

GGAACAGTGACAGGAGGGAATCCTGCCAAGGGGCAGGAGGGGTCCCGAGAAGTCAGGGATTAGGAGTGAAGGGAGTAGATGTGGAGGTCCGAGCATGTGA

ATCAGGGACGAGACGGACAGGCGTGAATGCAGGGGAGGCCAGAGTATTGGGATGCGACGCGACTTACTCCCAACATGCCCCTGAGCATGCTTTAGCTCAC

CTAGAGCTGACCAGCTCCAACCCAACCTGTGGCCTGGACTGGGCCAGGTGCCTGTCCCATTGTCCTGCAGTTTCGAGGACAGAGTGGGGTATGTTTCCTT

TTTGTTGGTGATGCATGCAGTTCAAGTGGACAAGAGAACAATATAACAAAACAAAAAAATTTACAACCACAAATCCCAGCACCAAAGTTGAGAAACCTTG

CTGGAAGTAGCTGATGCAACCATACGTAGGCTTAGGTGACACTGTGGCTCTTAACTGTCCTGTTGACGCCTCTTCATCCTATTCTCACAATGCCGCATGC

TTAAATCGTAATAGAAGTCATCTTCTATGCCCGGGTAGGGTAGGGCACCCTCTCTCCTTATCTCCTGTGTTGGGGAGGCGGAATGAAGTAGGGAGAGAGT

AGCAAGCCCGGCCCCACCCTTACCATTCTGAGGCTGGCCGCAGCATGGCTAGCCTTTGTGTGTACTTAGGTCACATGGCTGGTCCCAGGGCCAGCACAGG

CCCAAGACTGGGCCTGATGGTTTTATTTTTATTTAACTTTATTTTCTGTGTGTTGTCTGTCTGTCTGTCTGTCTGTGTTGTCTTTGTCTACTGCCCTCTA

ATGTTAAGTGGGAGTCTGGAGGAGTCTCCCACTTCCCCACCTTCTCCCAAGTCCTTCCCTCTGTCACCAGCCATCCCTCAGGCCCAGGCAGAGTGGGTCT

CGGGCAGGTAGGGACCTGGAGTGGCCTGGTCCCACCCTCTGACCTCCTCCTCAGGCCACCAGTGTTGCCCTCTTCCCTTTTTAAAACAAAATACCCTTGT

TTGTAAATCCTTAGACGCTTGAGAATAAAACCCTTCCCTTTTCTTCCGA
Translation
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPI - UNI12646 - IIVITLSPAPAPSQRAA ALQLPLANDGGSRSPSSESSPQHPTP

PTRPRHMLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRI

LMDLDVVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCD

FGISGRLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKD

C CLTKDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
Transcript ENSMUST00000110998
Sequence
AGCGCAGGCGCAGTGCGGTGTTTGTCTACCCCGGACTGACGGGTGGCCTGGCGGTGAGCGGCGGCAGCGGCGGCGGGGAAGATGGCGGCGTCCTCCCTGG

AGCAGAAGCTGTCCCGCCTGGAAGCCAAGCTGAAGCAGGAGAACCGTGAGGCCCGCAGGAGGATCGACCTCAACTTGGATATCAGCCCACAGCGGCCCAG

GCCCA - UNI12646 - CCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCACCCTACACCCCCCA

CCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAGGAGATCATGAAGC

AGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACCTGTGGTCAGGTGT

GGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATTTTGATGGACCTGG

ATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATGGAGCTCATGGGCA

CATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCACTGTACTATCTGA

AGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTGGCATCAGTGGCCG

CCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCAAGCCTGACTATGA

CATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACTTTGAGGTCCTCAC

CAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTACTAAAGATCACAG

GAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTAAGGATGTCATGGC

GAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAGGTAGCCTCATGGCAGCGGCCAGCCCCGCAGGGGCCCCGGG

CCACGGCCACCGACCCCCCCCCCAACCTGGCCAACCCAGCTGCCCATCAGGGGACCTGGGACCTGGACGACTGCCAAGGACTGAGGACAGAAAGTAGGGG

GTTCCCATCCAGCTCTGACTCCCTGCCTACCAGCTGTGGACAAAAGGGCATGCTGGTTCCTAATCCCTCCCACTCTGGGGTCAGCCAGCAGTGTGAGCCC

CATCCCACCCCGACAGACACTGTGAACGGAAGACAGCAGGCC
Translation
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPT - UNI12646 - TLQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPR

SMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRILMDLDVVLKSHDCPYIVQ

CFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAG

CAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC CLTKDHRKRPKYNKLL

 EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
Transcript ENSMUST00000110999
Sequence
AGCGCAGGCGCAGTGCGGTGTTTGTCTACCCCGGACTGACGGGTGGCCTGGCGGTGAGCGGCGGCAGCGGCGGCGGGGAAGATGGCGGCGTCCTCCCTGG

AGCAGAAGCTGTCCCGCCTGGAAGCCAAGCTGAAGCAGGAGAACCGTGAGGCCCGCAGGAGGATCGACCTCAACTTGGATATCAGCCCACAGCGGCCCAG

GCCCA - UNI12646 - CCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCACCCTACACCCCCCA

CCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAGGAGATCATGAAGC

AGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACCTGTGGTCAGGTGT

GGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATTTTGATGGACCTGG

ATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATGGAGCTCATGGGCA

CATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCACTGTACTATCTGA

AGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTGGCATCAGTGGCCG

CCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCAAGCCTGACTATGA

CATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACTTTGAGGTCCTCAC

CAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTACTAAAGATCACAG

GAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTAAGGATGTCATGGC

GAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAG TGGGAGTCTGGAGGAGTCTCCCACTTCCCCACCTTCTCC

CAAGTCCTTCCCTCTGTCACCAGCCATCCCTCAGGCCCAGGCAGAGTGGGTCTCGGGCAGGTAGGGACCTGGAGTGGCCTGGTCCCACCCTCTGACCTCC

TCCTCAGGCCACCAGTGTTGCCCTCTTCCCTTTTTAAAACAAAATACCCTTGTTTGTAAATCCTTAGACGCTTGAGAATAAAACCCTTCCCTTTTCTTCC

GA
Translation
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPT - UNI12646 - TLQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPR

SMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRILMDLDVVLKSHDCPYIVQ

CFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAG

CAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC CLTKDHRKRPKYNKLL

 EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFS SGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
Transcript ENSMUST00000003027
Sequence
TGACGGGTGGCCTGGCGGTGAGCGGCGGCAGCGGCGGCGGGGAAGATGGCGGCGTCCTCCCTGGAGCAGAAGCTGTCCCGCCTGGAAGCCAAGCTGAAGC

AGGAGAACCGTGAGGCCCGCAGGAGGATCGACCTCAACTTGGATATCAGCCCACAGCGGCCCAGGCCCA - UNI12646 - TTATTGTGATCACTCTA

AGCCCTGCTCCTGCCCCGTCCCAGCGAGCAG CCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCAC

CCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAG

GAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACC

TGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATT

TTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATG

GAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCA

CTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTG

GCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCA

AGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACT

TTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTA

CTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTA

AGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAG TGGGAGTCTGGAGGAGTCTCCCACTT

CCCCACCTTCTCCCAAGTCCTTCCCTCTGTCACCAGCCATCCCTCAGGCCCAGGCAGAGTGGGTCTCGGGCAGGTAGGGACCTGGAGTGGCCTGGTCCCA

CCCTCTGACCTCCTCCTCAGGCCACCAGTGTTGCCCTCTTCCCTTTTTAAAACAAAATACCCTTGTTTGTAAATCCTTAGACGCTTGAGAATAAAACCCT

TCCCTTTTCTTCCGA
Translation
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPI - UNI12646 - IIVITLSPAPAPSQRAA ALQLPLANDGGSRSPSSESSPQHPTP

PTRPRHMLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRI

LMDLDVVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCD

FGISGRLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKD

C CLTKDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFS SGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
Transcript ENSMUST00000052385
Sequence
TGACGGGTGGCCTGGCGGTGAGCGGCGGCAGCGGCGGCGGGGAAGATGGCGGCGTCCTCCCTGGAGCAGAAGCTGTCCCGCCTGGAAGCCAAGCTGAAGC

AGGAGAACCGTGAGGCCCGCAGGAGGATCGACCTCAACTTGGATATCAGCCCACAGCGGCCCAGGCCCA - UNI12646 - TTATTGTGATCACTCTA

AGCCCTGCTCCTGCCCCGTCCCAGCGAGCAG CCCTGCAACTCCCACTGGCCAACGATGGGGGCAGCCGCTCACCATCCTCAGAGAGCTCCCCACAGCAC

CCTACACCCCCCACCCGGCCCCGCCACATGCTGGGGCTCCCATCAACCTTGTTCACACCGCGCAGTATGGAGAG CATCGAGATTGACCAGAAGCTGCAG

GAGATCATGAAGCAGACAGGGTACCTGACTATCGGGGGCCAG CGTTATCAGGCAGAAATCAATGACTTGGAGAACTTGGGTGAGATGGGCAGTGGTACC

TGTGGTCAGGTGTGGAAGATGCGGTTCCGGAAGACAGGCCACATCATTGCTGTTAAG CAAATGCGGCGCTCTGGGAACAAGGAAGAGAATAAGCGCATT

TTGATGGACCTGGATGTAGTACTCAAGAGCCATGACTGCCCTTACATCGTTCAGTGCTTTGGCACCTTCATCACCAAC ACAGACGTCTTTATTGCCATG

GAGCTCATGGGCACATGTGCAGAGAAGCTGAAGAAACGAATGCAGGGCCCCATTCCAGAGCGAATCCTGGGCAAGATGACTGTGGCG ATTGTGAAAGCA

CTGTACTATCTGAAGGAGAAGCATGGCGTCATCCATCGCGATGTCAAACCCTCCAACATCCTGCTAGATGAGCGGGGCCAGATCAAGCTCTGTGACTTTG

GCATCAGTGGCCGCCTTGTTGACTCCAAAGCCAAAACACGGAGTGCTGGCTGTGCTGCCTATATGGCT CCCGAGCGCATCGACCCTCCAGATCCCACCA

AGCCTGACTATGACATCCGAGCTGATGTGTGGAGCCTGGGCATCTCACTG GTGGAGCTGGCAACAGGACAGTTCCCCTATAAGAACTGCAAGACGGACT

TTGAGGTCCTCACCAAAGTCCTACAGGAAGAGCCCCCACTCCTGCCTGGTCACATGGGCTTCTCAGGGGACTTCCAGTCATTTGTCAAAGACTG CCTTA

CTAAAGATCACAGGAAGAGACCAAAGTATAATAAGCTACTT GAACACAGCTTCATCAAGCACTATGAGATACTCGAGGTGGATGTCGCGTCCTGGTTTA

AGGATGTCATGGCGAAGACCGAGTCCCCAAGGACTAGTGGAGTCCTGAGTCAGCACCATCTGCCCTTCTTCAG CACCTCTGTTACCTGGGGCGCCTGGC

CCCTGGCTGCGCAGACCCCTTTTCAGTCTGGAGTTATCAGATGCAGAGGACGCGTTCCCTCGCCGCGCAGGGCCACTGGAGGTTCCGGCGGACAGCCATG

TGTTTGTGCAG GCGGCCCTGGCCCGTCCTTCACCGAGATGGGGCCTAGCCCTTCACCGATGCTCAGTAACACCTTCTTCACGCCCGACCCTGGGGCCTG

CCCTGGTGCTTCTACGTGGGGGCTGCCCCGCCGACGACTCTGTCAGCTTCTCACCACCTCCACGCCCGGATGCTGCTAG
Translation
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPI - UNI12646 - IIVITLSPAPAPSQRAA ALQLPLANDGGSRSPSSESSPQHPTP

PTRPRHMLGLPSTLFTPRSMES SIEIDQKLQEIMKQTGYLTIGGQ RYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVK QMRRSGNKEENKRI

LMDLDVVLKSHDCPYIVQCFGTFITN TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVA IVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCD

FGISGRLVDSKAKTRSAGCAAYMA PERIDPPDPTKPDYDIRADVWSLGISL VELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKD

C CLTKDHRKRPKYNKLL EHSFIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFS STSVTWGAWPLAAQTPFQSGVIRCRGRVPSPRRATG

GSGGQPCVCAG GGPGPSFTEMGPSPSPMLSNTFFTPDPGACPGASTWGLPRRRLCQLLTTSTPGCC

For any suggestions or comments, please send an email to unitrap@crg.es