Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000002983 (Relb)
Chromosomal location
Chr 7: 20191572 - 20214787 (-)
Description
avian reticuloendotheliosis viral (v-rel) oncogene related B Gene [Source:MGI (curated);Acc:Relb-001]
RefSeq_dna
NM_009046 
RefSeq_peptide
NP_033072.2 
MGI
MGI:103289 
Uniprot/SWISSPROT
Q04863 
Uniprot/SPTREMBL
Q4U110 Q4U109 Q4U112 Q8K220 Q3U0K7 Q8VE46 
Human Ortholog
ENSG00000104856 (RELB)
Omim not available
UniTrap UNI31231
Vector Insertion
Chr 7: 20212504 - 20213320
Public Clones IST13064A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30227
Vector Insertion
Chr 7: 20208274 - 20212507
Public Clones D072B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17676
Vector Insertion
Chr 7: 20205192 - 20206469
Public Clones IST10227F11 (tigm)
Private Clones OST438296 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31379
Vector Insertion
Chr 7: 20203110 - 20205192
Public Clones IST13652B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30409
Vector Insertion
Chr 7: 20192291 - 20196971
Public Clones (sanger) CMHD-GT_393E7-3 (cmhd) IST10318H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15951
Vector Insertion
Chr 7: 20191571 - 20192291
Public Clones not available
Private Clones OST469496 (lexicon) OST336263 (lexicon) OST45497 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098754
Sequence
CTTCGGCCCTAGCCTTGCACCGCTTGCCCGGCCGGTGATCGTCCCAGCCGACCGGGCTGTCCGACTGCCCGGCTTGCCCTCGTGTGCGCTCGCCCTGAGC

TGGCCTTCGGGCTGTCGGTCCCTACGGGCCGGGCCATGCCGAGTCGCCGCGCTGCCAGAGAGTCCGCGCCCGAGCTAGGGGCCTTGG - UNI31231 -

 GTTCCAGTGACCTCTCTTCCCTGTCACTAACGGTCTCCAGGACCACAG - UNI30227 - - UNI31231 - AT - UNI30227 - - UNI312

31 - GACTTAGGAGCCATGGGAGTCTTCTACGCAAAAGAGAAACGG - UNI17676 - - UNI31379 - AAATCATCGACGAATACATTAAGGAG

AACGGCTTTGGCCTGGACGGGACACAGCTGAGTGAGATGCCGCGCCTGGTGCCCCGCGGGCCCGCCTCACTGAGCAGCGTCACGCTGGGCCCTGCTGCAC

CACCGCCTCCGGCCACGCCGTCCTGGAGCTGCACACTGGGCAGGCTGGTGTCACCCGGCCCGTGCCCACGGCCGTACCTGGTCATCACAGAGCAGCCAAA

GCAGCGTGGCATGCGCTTCCGCTACGAGTGCGAGGGCCGCTCGGCCGGCAGCATCCTCGGGGAGAGCAGCACCGAAGCCAGCAAGACCCTGCCCGCCATC

GAG - UNI31379 - CTTCGAGACTGTGGCGGGCTGCGGGAGGTGGAGGTGACGGCGTGCCTGGTGTGGAAGGACTGGCCACACCGGGTACACCCACA

TAGCCTCGTGGGGAAAGACTGCACGGACGGCGTCTGCAGGGTGCGGCTGCGGCCTCACGTCAGCCCCCGGCACAG - UNI31379 - CTTTAACAACC

TGGGCATCCAGTGTGTTAGGAAGAAGGAAATTGAAGCTGCCATTGAGCGGAAGATCCAGCTGGGAATTGACCCCTACAATG CTGGCTCCCTGAAGAACC

ATCAGGAGGTCGACATGAATGTCGTCAGGATCTGCTTCCAGGCCTCCTATCGGGACCAGCAGGGACATCTGCACCGCATGGACCCCATCCTCTCTGAGCC

TGTCTACGACAAGA AGTCCACCAACACATCGGAGCTGCGGATTTGCCGAATCAACAAGGAGAGCGGGCCGTGCACAGGTGGTGAGGAGCTGTACTTGCT

CTGTGACAAGGTGCAAAAAG AGGACATATCCGTGGTGTTCAGCACAGCTTCCTGGGAAGGCCGTGCCGACTTCTCTCAAGCTGATGTGCACCGGCAGAT

CGCCATTGTGTTCAAAACGCCACCCTACGAGGACCTGGAGATCTCAGAGCCCGTGACTGTCAATGTGTTCTTGCAGCGGCTCACGGATGGGGTGTGCAGC

GAGCCGCTGCCCTTCACGTACCTGCCTCGGGATCATG ACAGCTACGGTGTGGACAAGAAGCGAAAGCGGGGACTGCCTGATGTCCTTGGAGAGTTGAGC

AGCTCTG ATCCACATGGAATCGAGAGCAAACGAAGGAAAAAGAAACCAGTGTTCTTGGACCACTTCCTGCCTGGCCACAGCTCAG - UNI15951 - 

- UNI30409 - GCCTGTTCCTCCCACCATCGGCTCTGCAGCCGGCAGACTCTGATTTCTTCCCTGCTTCCATATCCCTTCCTGGGCTGGAGCCTCCTG

GTGGACCCGATCTCCTGGACGATGGCTTTGCCTATGATCCTTCTGCCCCCACGCTCTTCACTATGTTGGACCTGCTGCCCCCAGCACCACCACTTGCCAG

TGCTGTGGTGGGTAGCGGGGGTGCAGGGGCCACCGTTGTGGAGTCTTCTGGCCCAGAGCCCCTATCACTGGACTCTTTTGCAGCGCCGGGCCCCGGGGAT

GTTGGTACTGCTAGCCTTGTGGGCAGCAACATGTTTCCCAACCAGTACCGAGAGGCAGCTTTCGGGGGTGGCCTCCTATCTCCAGGGCCTGAAGCCACGT

AGCCTCTGAGGTAACAGAGGAGGCACTGGGTGAGGTATGTGGTATAGCACTCCATTCCGAAGCCAACCTTGATCAGTCTTCCAGCTTCCTCATCCTGAAT

CGGACATCTGCAGCGCTGGTGGGAAGATGGGGAGCACTC
Translation
MPSRRAARESAPELGALG - UNI31231 - GSSDLSSLSLTVSRTTD - UNI30227 - - UNI31231 - D - UNI30227 - - UNI3123

1 - DLGAMGVFYAKEKR - UNI17676 - - UNI31379 - KSSTNTLRRTALAWTGHS - UNI31379 -  - UNI31379 -       - U

NI15951 - - UNI30409 - 
Transcript ENSMUST00000108452
Sequence
GCCCGCCGCCCGCTCGGCCCGGCGCCCCCCGCAGCCCCGGGCGCCGTGCGTCCAGCCCGGCCTTCGGCCCTAGCCTTGCACCGCTTGCCCGGCCGGTGAT

CGTCCCAGCCGACCGGGCTGTCCGACTGCCCGGCTTGCCCTCGTGTGCGCTCGCCCTGAGCTGGCCTTCGGGCTGTCGGTCCCTACGGGCCGGGCCATGC

CGAGTCGCCGCGCTGCCAGAGAGTCCGCGCCCGAGCTAGGGGCCTTGG - UNI31231 - GTTCCAGTGACCTCTCTTCCCTGTCACTAACGGTCTCC

AGGACCACAG - UNI30227 - - UNI31231 - ATGAATTGG - UNI17676 - - UNI30227 - - UNI31379 - AAATCATCGACGAA

TACATTAAGGAGAACGGCTTTGGCCTGGACGGGACACAGCTGAGTGAGATGCCGCGCCTGGTGCCCCGCGGGCCCGCCTCACTGAGCAGCGTCACGCTGG

GCCCTGCTGCACCACCGCCTCCGGCCACGCCGTCCTGGAGCTGCACACTGGGCAGGCTGGTGTCACCCGGCCCGTGCCCACGGCCGTACCTGGTCATCAC

AGAGCAGCCAAAGCAGCGTGGCATGCGCTTCCGCTACGAGTGCGAGGGCCGCTCGGCCGGCAGCATCCTCGGGGAGAGCAGCACCGAAGCCAGCAAGACC

CTGCCCGCCATCGAG - UNI31379 - CTTCGAGACTGTGGCGGGCTGCGGGAGGTGGAGGTGACGGCGTGCCTGGTGTGGAAGGACTGGCCACACCG

GGTACACCCACATAGCCTCGTGGGGAAAGACTGCACGGACGGCGTCTGCAGGGTGCGGCTGCGGCCTCACGTCAGCCCCCGGCACAGGTACCAGACCCCG

ACCTTTGACCCCAGCTTCTCACCTCTGCTCATGGAGATTCCACAG ACGAGGAGACAGAGGGTCATCAGAGCTGCCTGTGGACTCCAGACCCAGCTTAAC

TGA
Translation
MPSRRAARESAPELGALG - UNI31231 - GSSDLSSLSLTVSRTTD - UNI30227 - - UNI31231 - DELE - UNI17676 - - UNI3

0227 - - UNI31379 - EIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGM

RFRYECEGRSAGSILGESSTEASKTLPAIE - UNI31379 - LRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHRYQT

PTFDPSFSPLLMEIPQ TRRQRVIRAACGLQTQLN
Transcript ENSMUST00000049912
Sequence
GCCCGCCGCCCGCTCGGCCCGGCGCCCCCCGCAGCCCCGGGCGCCGTGCGTCCAGCCCGGCCTTCGGCCCTAGCCTTGCACCGCTTGCCCGGCCGGTGAT

CGTCCCAGCCGACCGGGCTGTCCGACTGCCCGGCTTGCCCTCGTGTGCGCTCGCCCTGAGCTGGCCTTCGGGCTGTCGGTCCCTACGGGCCGGGCCATGC

CGAGTCGCCGCGCTGCCAGAGAGTCCGCGCCCGAGCTAGGGGCCTTGG - UNI31231 - GTTCCAGTGACCTCTCTTCCCTGTCACTAACGGTCTCC

AGGACCACAG - UNI17676 - - UNI30227 - - UNI31231 - - UNI31379 - AAATCATCGACGAATACATTAAGGAGAACGGCTTTGG

CCTGGACGGGACACAGCTGAGTGAGATGCCGCGCCTGGTGCCCCGCGGGCCCGCCTCACTGAGCAGCGTCACGCTGGGCCCTGCTGCACCACCGCCTCCG

GCCACGCCGTCCTGGAGCTGCACACTGGGCAGGCTGGTGTCACCCGGCCCGTGCCCACGGCCGTACCTGGTCATCACAGAGCAGCCAAAGCAGCGTGGCA

TGCGCTTCCGCTACGAGTGCGAGGGCCGCTCGGCCGGCAGCATCCTCGGGGAGAGCAGCACCGAAGCCAGCAAGACCCTGCCCGCCATCGAG - UNI31

379 - CTTCGAGACTGTGGCGGGCTGCGGGAGGTGGAGGTGACGGCGTGCCTGGTGTGGAAGGACTGGCCACACCGGGTACACCCACATAGCCTCGTGG

GGAAAGACTGCACGGACGGCGTCTGCAGGGTGCGGCTGCGGCCTCACGTCAGCCCCCGGCACAG - UNI31379 - CTTTAACAACCTGGGCATCCAG

TGTGTTAGGAAGAAGGAAATTGAAGCTGCCATTGAGCGGAAGATCCAGCTGGGAATTGACCCCTACAATG CTGGCTCCCTGAAGAACCATCAGGAGGTC

GACATGAATGTCGTCAGGATCTGCTTCCAGGCCTCCTATCGGGACCAGCAGGGACATCTGCACCGCATGGACCCCATCCTCTCTGAGCCTGTCTACGACA

AGA AGTCCACCAACACATCGGAGCTGCGGATTTGCCGAATCAACAAGGAGAGCGGGCCGTGCACAGGTGGTGAGGAGCTGTACTTGCTCTGTGACAAGG

TGCAAAAAG AGGACATATCCGTGGTGTTCAGCACAGCTTCCTGGGAAGGCCGTGCCGACTTCTCTCAAGCTGATGTGCACCGGCAGATCGCCATTGTGT

TCAAAACGCCACCCTACGAGGACCTGGAGATCTCAGAGCCCGTGACTGTCAATGTGTTCTTGCAGCGGCTCACGGATGGGGTGTGCAGCGAGCCGCTGCC

CTTCACGTACCTGCCTCGGGATCATG ACAGCTACGGTGTGGACAAGAAGCGAAAGCGGGGACTGCCTGATGTCCTTGGAGAGTTGAGCAGCTCTG ATC

CACATGGAATCGAGAGCAAACGAAGGAAAAAGAAACCAGTGTTCTTGGACCACTTCCTGCCTGGCCACAGCTCAG - UNI15951 - - UNI30409 

- GCCTGTTCCTCCCACCATCGGCTCTGCAGCCGGCAGACTCTGATTTCTTCCCTGCTTCCATATCCCTTCCTGGGCTGGAGCCTCCTGGTGGACCCGAT

CTCCTGGACGATGGCTTTGCCTATGATCCTTCTGCCCCCACGCTCTTCACTATGTTGGACCTGCTGCCCCCAGCACCACCACTTGCCAGTGCTGTGGTGG

GTAGCGGGGGTGCAGGGGCCACCGTTGTGGAGTCTTCTGGCCCAGAGCCCCTATCACTGGACTCTTTTGCAGCGCCGGGCCCCGGGGATGTTGGTACTGC

TAGCCTTGTGGGCAGCAACATGTTTCCCAACCAGTACCGAGAGGCAGCTTTCGGGGGTGGCCTCCTATCTCCAGGGCCTGAAGCCACGTAGCCTCTGAGG

TAACAGAGGAGGCACTGGGTGAGGTATGTGGTATAGCACTCCATTCCGAAGCCAACCTTGATCAGTCTTCCAGCTTCCTCATCCTGAATCGGACATCTGC

AGCGCTGGTGGGAAGATGGGGAGCACTCCGGTTCTCTTTGAGCCCATTTTACAGAATGCTGAGTCCGAAGAGGAAAAGGGGCTCCTGCAGATGGACCCCT

TCTCAGGACAGATTCTCAGAGATTGTACATAGGGGAGGAGGGAGCAGGTCCCCAGCCTTCTCCCCTAATCCTGAAGAAGGCAGTGGATTGTTCAGTTTTC

CCAATAAAAATTAGTTTTTTG
Translation
MPSRRAARESAPELGALG - UNI31231 - GSSDLSSLSLTVSRTTE - UNI17676 - - UNI30227 - - UNI31231 - - UNI31379 

- EIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGES

STEASKTLPAIE - UNI31379 - LRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHS - UNI31379 - SFNNLGI

QCVRKKEIEAAIERKIQLGIDPYNA AGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKK KSTNTSELRICRINKESGPCTGGEELYL

LCDKVQKE EDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHD DSYGVDKKRKRGLPDVL

GELSSSD DPHGIESKRRKKKPVFLDHFLPGHSSG - UNI15951 - - UNI30409 - GLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDG

FAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT
Transcript ENSMUST00000094762
Sequence
GCCCGCCGCCCGCTCGGCCCGGCGCCCCCCGCAGCCCCGGGCGCCGTGCGTCCAGCCCGGCCTTCGGCCCTAGCCTTGCACCGCTTGCCCGGCCGGTGAT

CGTCCCAGCCGACCGGGCTGTCCGACTGCCCGGCTTGCCCTCGTGTGCGCTCGCCCTGAGCTGGCCTTCGGGCTGTCGGTCCCTACGGGCCGGGCCATGC

CGAGTCGCCGCGCTGCCAGAGAGTCCGCGCCCGAGCTAGGGGCCTTGG - UNI31231 - GTTCCAGTGACCTCTCTTCCCTGTCACTAACGGTCTCC

AGGACCACAG - UNI30227 - - UNI31231 - ATGAATTGG - UNI17676 - - UNI30227 - - UNI31379 - AAATCATCGACGAA

TACATTAAGGAGAACGGCTTTGGCCTGGACGGGACACAGCTGAGTGAGATGCCGCGCCTGGTGCCCCGCGGGCCCGCCTCACTGAGCAGCGTCACGCTGG

GCCCTGCTGCACCACCGCCTCCGGCCACGCCGTCCTGGAGCTGCACACTGGGCAGGCTGGTGTCACCCGGCCCGTGCCCACGGCCGTACCTGGTCATCAC

AGAGCAGCCAAAGCAGCGTGGCATGCGCTTCCGCTACGAGTGCGAGGGCCGCTCGGCCGGCAGCATCCTCGGGGAGAGCAGCACCGAAGCCAGCAAGACC

CTGCCCGCCATCGAG - UNI31379 - CTTCGAGACTGTGGCGGGCTGCGGGAGGTGGAGGTGACGGCGTGCCTGGTGTGGAAGGACTGGCCACACCG

GGTACACCCACATAGCCTCGTGGGGAAAGACTGCACGGACGGCGTCTGCAGGGTGCGGCTGCGGCCTCACGTCAGCCCCCGGCACAG - UNI31379 -

 CTTTAACAACCTGGGCATCCAGTGTGTTAGGAAGAAGGAAATTGAAGCTGCCATTGAGCGGAAGATCCAGCTGGGAATTGACCCCTACAATG CTGGCT

CCCTGAAGAACCATCAGGAGGTCGACATGAATGTCGTCAGGATCTGCTTCCAGGCCTCCTATCGGGACCAGCAGGGACATCTGCACCGCATGGACCCCAT

CCTCTCTGAGCCTGTCTACGACAAGA AGTCCACCAACACATCGGAGCTGCGGATTTGCCGAATCAACAAGGAGAGCGGGCCGTGCACAGGTGGTGAGGA

GCTGTACTTGCTCTGTGACAAGGTGCAAAAAG AGGACATATCCGTGGTGTTCAGCACAGCTTCCTGGGAAGGCCGTGCCGACTTCTCTCAAGCTGATGT

GCACCGGCAGATCGCCATTGTGTTCAAAACGCCACCCTACGAGGACCTGGAGATCTCAGAGCCCGTGACTGTCAATGTGTTCTTGCAGCGGCTCACGGAT

GGGGTGTGCAGCGAGCCGCTGCCCTTCACGTACCTGCCTCGGGATCATG ACAGCTACGGTGTGGACAAGAAGCGAAAGCGGGGACTGCCTGATGTCCTT

GGAGAGTTGAGCAGCTCTG ATCCACATGGAATCGAGAGCAAACGAAGGAAAAAGAAACCAGTGTTCTTGGACCACTTCCTGCCTGGCCACAGCTCAG -

 UNI15951 - - UNI30409 - GCCTGTTCCTCCCACCATCGGCTCTGCAGCCGGCAGACTCTGATTTCTTCCCTGCTTCCATATCCCTTCCTGGGC

TGGAGCCTCCTGGTGGACCCGATCTCCTGGACGATGGCTTTGCCTATGATCCTTCTGCCCCCACGCTCTTCACTATGTTGGACCTGCTGCCCCCAGCACC

ACCACTTGCCAGTGCTGTGGTGGGTAGCGGGGGTGCAGGGGCCACCGTTGTGGAGTCTTCTGGCCCAGAGCCCCTATCACTGGACTCTTTTGCAGCGCCG

GGCCCCGGGGATGTTGGTACTGCTAGCCTTGTGGGCAGCAACATGTTTCCCAACCAGTACCGAGAGGCAGCTTTCGGGGGTGGCCTCCTATCTCCAGGGC

CTGAAGCCACGTAGCCTCTGAGGTAACAGAGGAGGCACTGGGTGAGGTATGTGGTATAGCACTCCATTCCGAAGCCAACCTTGATCAGTCTTCCAGCTTC

CTCATCCTGAATCGGACATCTGCAGCGCTGGTGGGAAGATGGGGAGCACTCCGGTTCTCTTTGAGCCCATTTTACAGAATGCTGAGTCCGAAGAGGAAAA

GGGGCTCCTGCAGATGGACCCCTTCTCAGGACAGATTCTCAGAGATTGTACATAGGGGAGGAGGGAGCAGGTCCCCAGCCTTCTCCCCTAATCCTGAAGA

AGGCAGTGGATTGTTCAGTTTTCCCAATAAAAATTAGTTTTTTG
Translation
MPSRRAARESAPELGALG - UNI31231 - GSSDLSSLSLTVSRTTD - UNI30227 - - UNI31231 - DELE - UNI17676 - - UNI3

0227 - - UNI31379 - EIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGM

RFRYECEGRSAGSILGESSTEASKTLPAIE - UNI31379 - LRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHS - 

UNI31379 - SFNNLGIQCVRKKEIEAAIERKIQLGIDPYNA AGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKK KSTNTSELRI

CRINKESGPCTGGEELYLLCDKVQKE EDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHD

 DSYGVDKKRKRGLPDVLGELSSSD DPHGIESKRRKKKPVFLDHFLPGHSSG - UNI15951 - - UNI30409 - GLFLPPSALQPADSDFFPAS

ISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGG

LLSPGPEAT

For any suggestions or comments, please send an email to unitrap@crg.es