Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003031 (Cdkn1b)
Chromosomal location
Chr 6: 134870419 - 134875531 (+)
Description
cyclin-dependent kinase inhibitor 1B Gene [Source:MGI (curated);Acc:Cdkn1b-002]
RefSeq_dna
NM_009875 
RefSeq_peptide
NP_034005.2 
UniGene
Mm.471167 Mm.2958 
MGI
MGI:104565 
Uniprot/SWISSPROT
P46414 
Uniprot/SPTREMBL
Q4FJM2 Q8BG74 
Human Ortholog
ENSG00000111276 (CDKN1B)
Omim 610755 - MULTIPLE ENDOCRINE NEOPLASIA, TYPE IV  
UniTrap UNI31004
Vector Insertion
Chr 6: 134871973 - 134872102
Public Clones IST13163F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003115
Sequence
AGTGTCAATCATCTTCTTCTTCGTCAGCCTCCCTTCCACCGCCATATTGGGCAACTAAAAAAGGAGGGGGGCTCGTGCTTTTGGGGTGTTTTCCCCCCTC

ATCCCTTGTCCCGACTCACTCGCGGCTCCGAGACTCGCGCGGCGGCAAGGTTTGGAGAGGGGCTGCGTTCGCGGGACACACGGGCTCGCCCCAGCCTACG

CTCCGACTGTTTGCCACCTCCTCCTGCCTCCTCCCCTCCCTTCCCCGCCCTCCAGTACACTTGATCACTGAAGCCTCGAGCTGCGCGGCGGCTGGGGTGT

CCCTGCGCCTCTCTTCCCCAGACCTGCGCGCTACTGCGGCTCGGGCGGTCGCTCGCCTGGCTCTGCTCCATTTGACTGTCTGTGTGCAGTCGCAGAACTT

CGAAGAGGGTTTTGCGCTCCATCCGTGGCGTTTCGCTTTTGTTCGGTTTTGTTGTTTATTTCATTTTTTTTTTTCCGGAGAGAGGCGAGGCGGTGGTCCA

CACCCGCCCGAGGAGGAAGATGTCAAACGTGAGAGTGTCTAACGGGAGCCCGAGCCTGGAGCGGATGGACGCCAGACAAGCGGAGCACCCCAAGCCTTCC

GCCTGCAGAAATCTCTTCGGCCCGGTCAATCATGAAGAACTAACCCGGGACTTGGAGAAGCACTGCCGGGATATGGAAGAAGCGAGTCAGCGCAAGTGGA

ATTTCGACTTTCAGAATCATAAGCCCCTGGAGGGCAGATACGAGTGGCAGGAGGTGGAGAGGGGCAGCTTGCCCGAGTTCTACTACAGGCCCCCGCGCCC

CCCCAAGAGCGCCTGCAAGGTGCTGGCGCAGGAGAGCCAGGATGTCAGCGGGAGCCGCCAGGCGGTGCCTTTAATTGGGTCTCAGGCAAACTCTGAGGAC

CGGCATTTGGTGGACCAAATGCCTGACTCGTCAGACAATCCGGCTGGGTTAGCGGAGCAGTGTCCAGGGATGAGGAAGCGACCTGCTGCAGAAG - UNI

31004 - ATTCTTCTTCGCAAAACAAAAGGGCCAACAGAACAGAAGAAAATGTTTCAGACGGTTCCCCGAACGCTGGCACTGTGGAGCAGACGCCCAAG

AAGCCCGGCCTTCGACGCCAGACGTAAACAGCTCCG - UNI31004 - AATTAAGAATATTTCCTTGTTTATTAGATACATCACTGCTTTATGAAGCA

AGGAAGATATACATGAAAAAATTTAAATACATATCGCTGACTCCATTGAATGGACATCCTGTATAAGCACTGAGAAAGCAAAAACAATAACACTAAAATT

TTAGGCACTCTTAAACCATCTGCCTCTAAAAGCATTGGATGTAGCATTGCGCAATTAGGTTGTTCCTTATTTGCTTTGTTGTACTACCTGTGTATATAGT

TTTTATCTTTTACTCTGTAGCACATAAACGTTAGGGATGGGAGGGCAGGGTGGGGCTGAGGAGTCAGCATGGGGGTGAAGAACTTGCTTCAATTTGTAGC

AAGGAGAAAAATATTTGACTTGCATAAAGAGAAGCAACCTGGGTGGGGGTGGGGGGGGGAAGGGTTTGAATTCCTTTCTTTAAAGATGTAGTGTCCCTTT

CGGTAAGAATGGATCCTTTATTTTTAAAATAATCAAAATTTGAATAATTGCTACACATGGTTGCTATTTATTTCTACATGAAGCTTATTCTCACTTGGAG

GTTCTGAAGATTCTGTTATAGAGCAAGAAATGGCTTAATTTTTTTTTTTAATTGGAATTTACCAGTTTATTGTTTAGCAGTAATTACCCCAGGTAACACT

GGGCAAAAATCTGGGGTGCATAATAGGGAATTCTGAATTCTTAGATTTGATTATCCCAGATCATTTTTGCTAAGAAAAATTCTTATTTCTTTTTTTCACA

GTGAACATAATCCTAAATCCTTGGATATTTTTAGAAGTCTGTAACTTTACACAAATAATGAAATAATTTTTAATTCAAAGTTTCTCACCCTACTTGTTAA

TTTGCCCCCAAGGAAAGTTGTTTTTTTTTTTTTTTTTTTTTTTAAGGAAAAAAGGACACTTGTAGAGTAAGTGAAATGGATACTACATCTTTAAACAGCG

TTTCTTCATTGCCTGTGTATGAGAAAAACTTGGAAGTGTGCCTGTGTATATAACTCTGTAAAGACACTGAAAATTATACTAACTTATTTATGTTAAAAAG

AGATTTTTTTTTAATCTAGACAATATACAAGCCAAAGTGGCATGTTTTGTGCATTTGTAAATGCTGTATTGGATAGACTAGCCCCCCCCCCGCCTTTGTT

AAATAGTATGGCTGTGCTTAAAAGGTTGCATACTGAGCCAAGTATAATTTTTGTAATGTGTGAAAAAGATGCCAATTATTGTTACACATCAAGCAATCAA

TAAAGAAAACTTCCGTAGTTA
Translation
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACK

VLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAED - UNI31004 - DSSSQNKRANRTEENVSDGSPNAGTVE

QTPKKPGLRRQT - UNI31004 - 
Transcript ENSMUST00000067327
Sequence
TTCTTCGTCAGCCTCCCTTCCACCGCCATATTGGGCAACTAAAAAAGGAGGGGGGCTCGTGCTTTTGGGGTGTTTTCCCCCCTCATCCCTTGTCCCGACT

CACTCGCGGCTCCGAGACTCGCGCGGCGGCAAGGTTTGGAGAGGGGCTGCGTTCGCGGGACACACGGGCTCGCCCCAGCCTACGCTCCGACTGTTTGCCA

CCTCCTCCTGCCTCCTCCCCTCCCTTCCCCGCCCTCCAGTACACTTGATCACTGAAGCCTCGAGCTGCGCGGCGGCTGGGGTGTCCCTGCGCCTCTCTTC

CCCAGACCTGCGCGCTACTGCGGCTCGGGCGGTCGCTCGCCTGGCTCTGCTCCATTTGACTGTCTGTGTGCAGTCGCAGAACTTCGAAGAGGGTTTTGCG

CTCCATCCGTGGCGTTTCGCTTTTGTTCGGTTTTGTTGTTTATTTCATTTTTTTTTTTCCGGAGAGAGGCGAGGCGGTGGTCCACACCCGCCCGAGGAGG

AAGATGTCAAACGTGAGAGTGTCTAACGGGAGCCCGAGCCTGGAGCGGATGGACGCCAGACAAGCGGAGCACCCCAAGCCTTCCGCCTGCAGAAATCTCT

TCGGCCCGGTCAATCATGAAGAACTAACCCGGGACTTGGAGAAGCACTGCCGGGATATGGAAGAAGCGAGTCAGCGCAAGTGGAATTTCGACTTTCAGAA

TCATAAGCCCCTGGAGGGCAGATACGAGTGGCAGGAGGTGGAGAGGGGCAGCTTGCCCGAGTTCTACTACAGGCCCCCGCGCCCCCCCAAGAGCGCCTGC

AAGGTGCTGGCGCAGGAGAGCCAGGATGTCAGCGGGAGCCGCCAGGCGGTGCCTTTAATTGGGTCTCAGGCAAACTCTGAGGACCGGCATTTGGTGGACC

AAATGCCTGACTCGTCAGACAATCCGGCTGGGTTAGCGGAGCAGTGTCCAGGGATGAGGAAGCGACCTGCTGCAGAAG - UNI31004 - ATTCTTCT

TCGCAAAACAAAAGGGCCAACAGAACAGAAGAAAATGTTTCAGACGGTTCCCCGAACGCTGGCACTGTGGAGCAGACGCCCAAGAAGCCCGGCCTTCGAC

GCCAGACGTAAACAGCTCCGGTGGGTTAATGAGGAAGAACACAAAACTGACACCCCATCTGGGCTGCGCTCCCCGGGGGGCCTGCAGACCCCAGGACTGC

TGGCAGATTAGTTGCCTGCCAGGAGGAATTACTTTCCTTGATCAAAAAAATTAACACTGGGGAAGGCTGGAATCACTTGAGGGGACTATAATGCAGTATT

TGCACCCCAAGATATTTACCTTAAAGTGGAATCAGAATGAGGTTCCCAAGCAAGAACTTGCCACCAAGGCCCCAAAGGATAGGGACGGTCGTATCCTTAT

GAATCCCACTAAAACTTAGGCTGGGAATGACAGTTTTCCTTTCCAGTCTCAGTTCATGAGAACCCATTTCCCAGAGGTTCGTTTTGAGCCAATAGCCTAT

TTTGAACCATTTGAACTGTAGAAAAATGGCAAATATATACTTACATGTATGTTCTTAAGAGAAAAACTAGGTACCCATAGTGCACGTTTGATTAGGAGTG

TGAATAGAGCTGCCGTGGCTCGAGTTCTTTTTATCTTTTGCTTTTGTTTTGGTTTTTGGTTTTTTGAGATAGGGTTTCTCTGTGTAACAAACAGCTCGGG

CTATTCTGGGAATTGCTCTGTAGACCACGCTGGCTTCGAACTCACAGAGATCTGTATTGTCTCTGCCTCCTGAGTGCTGAGATTAGAGGTTGTGTGCCAT

CACCTCTGGGTACTTTTTTATTTTTTTTTAAAGTTGTGCCTTGTATGCTGGTAAATTTTGGAGAGAAAGGAACTTCATACTTAAAAAAAAAATTAGACTG

GAAAGTTCAGAAGTACTAATGCTCCCACAGAATTGATTTTAACCCTGAGGTTACAAAGCAGAAGTTAAATGAACAGCTAGAGGAAGCAGCCTTCCCACAC

GTCAGCACCGTATGCTAATTTGCTGGAACAGGACGGTTTGGATGTTTATAGGGGAAATGGATAGTAGATGTTAGGACCAACTGAGAAGGTCCAACACAAG

TGTGGATTTTTCCATGTGTCAAAAATCTCATCACCCCACTTGCCTAATTAGAGTAACCCAGCCCCTAAATTTACATAGATTGACTATTCATATGCTCTAA

CTACTTATAATAGTTTATAAGCTCCTTATGAAGAAAACCAGCATTCTCTATTTCTAAAGCCCACTTATAACCCAGCATACAAATAGATCTTAACAGTTTA

TTATTAACTTTTCAGGTCCTCATTTATTGAAATTTAAAAATAAATGAAGGAATATAGAGATGGCACAGGGTTCCAGCTTGTTGTGTTTATAAATCATAAA

GTCATGATATACCTTCTACAGACATAGCATTTTTTCAGAGATGGAAAATGGCCATTAGAGTCACTTTCCATATTATACCCTCTATAAAGTTGTCGAATTG

GATGGGAGTTCTTTCTAACTAGCCATCACACCTGTAGCTTTAGTTGCTTTGTGTGGCTTCTGGCCTAGCTTTTCAGATGAGCCGCCTGGATTTTTACCTG

GCCTGTTCTGATAAAGAGGCATTTATTAGCCAAGCAACCATAAGACTCTAGTCAAAAGCACTCGTGCAGATATGCTGCATATGAGTAAGAAATTGCAATT

TTGTAAACATTCCTCGACTTGGTGGGGAGGAATAATTTTATAATTGCATTTCCAGGTATTTTTCAAGATTACGAAAATATGCTACTCTGATGTGTTATGG

TTCCTGAATTTCTTTTCTTTCTCACCCTCTTTGACCCAGATTTTATAGAGCGAGTTTCTCAACCTCTGCACAGTTGACATTTTGAGCCAAATTATTCTTT

GTTGTGGTAGGCAGTCCTGTGCATTTTAGAATGTTTGGCATTATCTCTGGCCTCCCCCACAAGATGCCAGTAGCAATCTTCTTCCCGAAGCTGTGACAAT

CAGAAATGTCTCTTAGACATTTCCAAATGTCCCCTGGGGCATGGGAGGGTTTCACAAAATTGCCCACTTGTTAAGGACCCTGACTCTAATACCAC
Translation
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACK

VLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAED - UNI31004 - DSSSQNKRANRTEENVSDGSPNAGTVE

QTPKKPGLRRQT

For any suggestions or comments, please send an email to unitrap@crg.es