Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003154 (Foxj2)
Chromosomal location
Chr 6: 122770529 - 122795359 (+)
Description
forkhead box J2 Gene [Source:MGI (curated);Acc:Foxj2-001]
RefSeq_dna
NM_021899 
RefSeq_peptide
NP_068699.1 
UniGene
Mm.410022 Mm.87142 
MGI
MGI:1926805 
Uniprot/SWISSPROT
Q9ES18 
Uniprot/SPTREMBL
Q3U3U9 
Human Ortholog
ENSG00000065970 (FOXJ2)
Omim not available
UniTrap UNI14435
Vector Insertion
Chr 6: 122770989 - 122778174
Public Clones FHCRC-GT-S13-10G1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29374
Vector Insertion
Chr 6: 122770989 - 122778174
Public Clones Ayu21-B101 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003238
Sequence
GGCTGGGAGAGGCTCCTCCCCTCCTCCCTAGGGTAGCAGGCAGGGGGTGGGGGGTGTGCCATCTTCCCCAGGTAGGTCCTCCCTCTCCCCCTCCTCCTCC

TTCGACTCCTCTTCCTCAGGGGACTCAGTTCCCTGCTCCAGCCTGGGAGGCTCCGCCAGGCACTGGAAGAGTCACTGAGGATGCCACCTGTCACCTGCCT

CTGAAGAGGGGAATCCCTGCAACCTCAAACTTCTGTACCAGGTGGTTTCCTCCAGCGGCGGGGGGAGCCTTGGAGACAG - UNI14435 - - UNI29

374 - AACCCAGAAGTACGATGGCCTCCGACCTGGAGAGTAGCCTCACCTCCATAGACTGGCTGCCACAGCTGACTCTCAGAGCCACTATTGAGAAGCT

TGGGAGCGCTTCTCAGGCTGGGCCTCCAGGGGGCGCCCGGAAGTGCTCCCCAGGCTCGCCCACAGATCCCAACGCCACCCTCAGCAAAGATGAGGCAGCG

GTCCACCAAGATGGCAAGCCACGGTACAGCTATGCCACCCTCATCACCTACGCCATCAACTCCTCCCCAGCTAAGAAGATGACTCTCAGTGAGATTTACC

GCTGGATCTGCGACAACTTCCCCTATTACAAGAACGCTGGCATCGGTTGGAAG AATTCCATTCGACACAACCTTTCCCTTAACAAGTGTTTCCGGAAGG

TGCCCAGACCTCGGGATGACCCTGGGAAG GGCTCCTATTGGACAATTGACACCTGCCCTGACATTTCCCGGAAGAGAAGACACCCTCCAGATGATGAC 

CTATCCCAAGACTCCCCAGAGCAGGAAGCCAGCAAAAGCCCCCGGGGAGGTGTTCCAGGGAGTGGAGAAGCCTCACTCTCTCACGAGGGGACTCCTCAGA

TGTCACTTCAGAGCCCCTCCTCCGTGGCCAACTACAGCCAG GGCCCAGGGTCTGTGGATGGTGGAGCAGTGGCAGCAGGGGCCCCAGGCCAGGAGAGCA

CAGAGGGCGCCCCTCCCCTCTACAACACCAACCATGACTTCAAATTCTCCTACTCAGAGATCAACTTTCAGGACCTAAGCTGGTCCTTCCGCAACCTCTA

CAAGTCCATGCTGGAGCGGTCCTCCTCCTCCCAGCACG GCTTTTCCTCACTCCTGGGAGACATGCCACCTTCTAACAACTACTACGTGTACCAGCAGCA

GCAACAGCAGCAGCCACCACCACAGCCACAGCCACCACCCCAGCAACCACAACCACAGCAGCAGCAGGCACCCACTCAGGGCCCCTCAAATGTAGGGGGT

GCCCCTCCACTGCACACCCCAAGCCCTGATGGCTGTACTACACCAGGGGGAAAACAAGCGGGCGCTGAAGGCTACGGCCCCCCGACTGGGATGGCCATGC

ATCCTCCCCCACTGCAGCACGGAGGCTACCACCCTCATCAGCACCATCCCCACTCCCACCCTGCCCAGCAGCCACCACAGCCACAGGCGCAGAGCCAGGC

ATCCATCAACAGCACTGGCTTTG CCTTTCCTCCTGACTGGTGCTCCAATATTGACTCCTTAAAGGAAAGCTTCAAAATGGTGAACCGGCTCAACTGGTC

CAGCATCGAGCAGTCCCAGTTCTCAG AGCTCATGGAGAGCCTACGGCAGGCAGAGCAGAGGAACTGGACCCTCGACCAGCATCACATCGCCAACTTGTG

TGACTCCCTCAACCACTTCCTCACCCAGACTGGTCACATGCCCCAACAAGGGGGCTCCCACCGACCACCTGCCCCTTCCCGCATCACTGACTCCTGTGCC

CTCACCAGTGGCAAACCGGAGCCATCCATGAACCAAG TGAACTCTTACGGGCACCCACAAGCTTCCCATCTCTACCCTGGCCCAGCACCAATGTACCCG

ATCTCCACCCAAGACTCAGCAGGATACAACCGCCCAG CACACCACATGGTTCCCCGGCCACCTGTCCCACCTCCTGGTGCCAATGAGGAGATCACCGAT

GACTTCGACTGGGACTTGATCACTTAATGAATCACAGTTGACATCAGCCCAAGGCCTGGTGGTGAATTCTGGCCACGGGGGAAGAGCAGTCCCCGGCTAT

CCTCCCCAAACCTGTATATAGATATATAGCTTCTTTCTGTTCTCTCTGTCAGAGACGCCACCGCAAGATGCTGCCGAGGATAATCCTCTTTTCCTCCTCA

TCCTTTGTTTCCCTCCTAGTTCATTATTATTCTAATTATATTATTATTATTATTATTGGTTACATACTGCCCAGTCTGCTGCCCTCTTACCCTGGGCTTT

GCCCTCCCTTTGCCCGTTTGAAATCTTCAGGTCTCAAGATGAGGCCGTGATAGCTGTCAGGAAAGGCTTCGAATGCTAGTTCACCTTTCTCTCTGAGAAA

CTCAGTGCTGATCCCACCTTTCAGCTCTGAACTGTGTTCTGTTCCTGTCTGTTTCAGGCTGGCCTGGAGAGGCCACAGTAAGTAGAGGGGAGGCTAAGAC

ACTGCTTGGCAACCATGACGTTGCAGTTTTACTCAATGGTGCTAATTGTGTCCTCTGCACTCTCCCATTATACATCCGATCTTTACTTTTTCCGGCAGTC

CTCATGCCCATGATGGGTGGACTTGGAGAGCTGGGTTCCGTAGAGCGCCATGGAGCAGTGATGGGTATAACCCAGCATGAGGTTGGGTATGCACTGCCAT

ATCAAAACATCCCTGGCTTCTTCCTGGTTGATGCTCTGGGGAGGTTAGCTTGTCCGCTCGGGCATGAAGACCACTGTGCATCCTAGGTTCAACTTCTTGG

AAACAATTTCAATTTAAGGCATTTTGGCTTTGGAAAAGGAATTCTTTCTGAGAGTTAGCTGGCTATTCTGCATATATAAATGACCTTCCATCATCTCTTC

TCCTTCAGCATATACTTTTTTGTCTTCCTAAAGCTGTTTGTCCAAATCATCTACCTGTTTTATTTTTTGTTCTCCCATTTTCTGGGAATCTCAAAAGACA

AAAGGAAGCCATTCTCACTCCTAGTTTCTTCATGTCATAGACATGCTGTGGAAACCTCTTTCCCTCCTGTCACAGCAGACTCATACCTGTGATACTGCTG

ACGGGAGGTTGGGGAGAAGAGAGGGAACTGGCGGAGATGTGGGTGGGAACCTGTCATTTGTTTAACTGCACAGGGAGACGCTTCTCTTGAAGTCCCTGTC

GGTGGGGTGGAAGCTTTTGATTTTGACAGGCAATGAATAATTACATTCCCCTGTAAGAGGGAGATGAATTATACAGAGACAGGGCGCAGCAAGGGCAAGG

CGCACTCCTAGGCACAGAGTGGGGAGTCTCCATTATCAATGAACGGCCATGATTTATTGCTGCAGAGGTCTTAGTGAGGGTGTGGTTGAATTCGATTCGA

GAGAGGGAAATCTCACTTCCACCTTATTTTCACTAAATTTTCTGAAACAGACAAAATGTGTAGTGTTGACAGGGCCAATCTCCGTGACTTTTGTTCATAT

GCTTTTATTTATCCATGATTTCCAAGACACTGGGCTTCCCATTCTCACTTCCCCTCATCAATCCCTTTCCTTTCTTTAGAAGGGGGCTTATGTATGAGAC

TGGTGAAGTCCAGTGAAGCTAAGTAAAGGGGCAAGATGGGGCAGTTCACTAAAGAGCACTTTATTTCTTTGTAAGGAAAAAAAAAGGGAGTATAAGAAAA

AGTTTCCTCCAGCAGTGTGCGATGTACTGGAGAGCATCTGGTGGGCCAGTGTATGAAGCAGTAGTTCCCGCTAGGGAACGGGGTGTTTCCCTAGAGGAGG

CACACACCTTTGCCAGGTGCCCTACTAGACATCTCTTGCTATGCCTCCCATCCAGGTGTAGTCTCCACAGCTTCCCTTTGGTTTCCTCGAGGTCTCTCCC

TTGCAGATTACCACCTCTTCTTCTAAGCACCTTTCCTGGTCAGATCTGTCCGCGGTTGGGGAGCTAGGCTGAGTCATACTCCCAGGTGCCCCGGCTTCTC

CATGTCTTGAGAACCAGTCTCCCTGGTGGGCAGCCAGAGCAGCTACAGTGGGCTGGAGACTGGAGGGTGGCTTTAGGCCCCCTGAGGTTCTAGCTCTCCA

GGGTCAGGCTTGCAGAACGGGGCAGTTTAAACCTGATCCCCTCTGGGCCTCCGATTCCCATGCCCTCCATGACGTGGAAAGGGAACTACTTTTATTTTGT

TGGTCCGGTATTGCTGGACATGAAGTACAGTCCTTGCTGTTGTCTTGGGTGATATTTGCACAGTTGTGGGGGTCACTGCCTATAAGAGGAAATAGGGGAG

ACAGCAGAGGTGCAGGACAAAGGAGAAGTCATTTGTGTTGCTCCACCTATCCTAGGCTTCCTCTCCTCAACCCCATGTTTCTGGTTTGGTGAGTTCTTTA

TACCACCCATAATGCTTTGCATTGGTGCAGGCTGGGAAGGGGGTGTATGGGCTCACAACTTGTTTGGTTTTTTTGTTTTGTTTTGTTTTTGTTTTTGTTT

TTTTGCATGCTTTCTT
Translation
 - UNI14435 - - UNI29374 - MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYAT

LITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWK NSIRHNLSLNKCFRKVPRPRDDPGK GSYWTIDTCPDISRKRRHPPDDD LSQDSPEQEAS

KSPRGGVPGSGEASLSHEGTPQMSLQSPSSVANYSQ GPGSVDGGAVAAGAPGQESTEGAPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLERSSSS

QHG GFSSLLGDMPPSNNYYVYQQQQQQQPPPQPQPPPQQPQPQQQQAPTQGPSNVGGAPPLHTPSPDGCTTPGGKQAGAEGYGPPTGMAMHPPPLQHGG

YHPHQHHPHSHPAQQPPQPQAQSQASINSTGFA AFPPDWCSNIDSLKESFKMVNRLNWSSIEQSQFSE ELMESLRQAEQRNWTLDQHHIANLCDSLNH

FLTQTGHMPQQGGSHRPPAPSRITDSCALTSGKPEPSMNQV VNSYGHPQASHLYPGPAPMYPISTQDSAGYNRPA AHHMVPRPPVPPPGANEEITDDF

DWDLIT
Transcript ENSMUST00000112575
Sequence
AATTGGTTCCAGTTTGCTGGAGAGTAGAAGACCTCGCCCCTCAACTTCCGTGCACCTAGACAGTGGACCGGGGCAGAGCCCCTCCACTCAGATCTCCAAC

TGACAGAAAGAGCCCTCAGCCCCTGAAAGATCCAGTTTGGGGGGGGAGGGGGATTCCCC TCCTCCCTAGGGTAGCAGGCAGGGGGTGGGGGGTGTGCCA

TCTTCCCCAGGTAGGTCCTCCCTCTCCCCCTCCTCCTCCTTCGACTCCTCTTCCTCAGGGGACTCAGTTCCCTGCTCCAGCCTGGGAGGCTCCGCCAGGC

ACTGGAAGAGTCACTGAGGATGCCACCTGTCACCTGCCTCTGAAGAGGGGAATCCCTGCAACCTCAAACTTCTGTACCAGGTGGTTTCCTCCAGCGGCGG

GGGGAGCCTTGGAGACAG - UNI14435 - - UNI29374 - AACCCAGAAGTACGATGGCCTCCGACCTGGAGAGTAGCCTCACCTCCATAGACTG

GCTGCCACAGCTGACTCTCAGAGCCACTATTGAGAAGCTTGGGAGCGCTTCTCAGGCTGGGCCTCCAGGGGGCGCCCGGAAGTGCTCCCCAGGCTCGCCC

ACAGATCCCAACGCCACCCTCAGCAAAGATGAGGCAGCGGTCCACCAAGATGGCAAGCCACGGTACAGCTATGCCACCCTCATCACCTACGCCATCAACT

CCTCCCCAGCTAAGAAGATGACTCTCAGTGAGATTTACCGCTGGATCTGCGACAACTTCCCCTATTACAAGAACGCTGGCATCGGTTGGAAG AATTCCA

TTCGACACAACCTTTCCCTTAACAAGTGTTTCCGGAAGGTGCCCAGACCTCGGGATGACCCTGGGAAG GGCTCCTATTGGACAATTGACACCTGCCCTG

ACATTTCCCGGAAGAGAAGACACCCTCCAGATGATGAC CTATCCCAAGACTCCCCAGAGCAGGAAGCCAGCAAAAGCCCCCGGGGAGGTGTTCCAGGGA

GTGGAGAAGCCTCACTCTCTCACGAGGGGACTCCTCAGATGTCACTTCAGAGCCCCTCCTCCGTGGCCAACTACAGCCAG GGCCCAGGGTCTGTGGATG

GTGGAGCAGTGGCAGCAGGGGCCCCAGGCCAGGAGAGCACAGAGGGCGCCCCTCCCCTCTACAACACCAACCATGACTTCAAATTCTCCTACTCAGAGAT

CAACTTTCAGGACCTAAGCTGGTCCTTCCGCAACCTCTACAAGTCCATGCTGGAGCGGTCCTCCTCCTCCCAGCACG GCTTTTCCTCACTCCTGGGAGA

CATGCCACCTTCTAACAACTACTACGTGTACCAGCAGCAGCAACAGCAGCAGCCACCACCACAGCCACAGCCACCACCCCAGCAACCACAACCACAGCAG

CAGCAGGCACCCACTCAGGGCCCCTCAAATGTAGGGGGTGCCCCTCCACTGCACACCCCAAGCCCTGATGGCTGTACTACACCAGGGGGAAAACAAGCGG

GCGCTGAAGGCTACGGCCCCCCGACTGGGATGGCCATGCATCCTCCCCCACTGCAGCACGGAGGCTACCACCCTCATCAGCACCATCCCCACTCCCACCC

TGCCCAGCAGCCACCACAGCCACAGGCGCAGAGCCAGGCATCCATCAACAGCACTGGCTTTG CCTTTCCTCCTGACTGGTGCTCCAATATTGACTCCTT

AAAGGAAAGCTTCAAAATGGTGAACCGGCTCAACTGGTCCAGCATCGAGCAGTCCCAGTTCTCAG AGCTCATGGAGAGCCTACGGCAGGCAGAGCAGAG

GAACTGGACCCTCGACCAGCATCACATCGCCAACTTGTGTGACTCCCTCAACCACTTCCTCACCCAGACTGGTCACATGCCCCAACAAGGGGGCTCCCAC

CGACCACCTGCCCCTTCCCGCATCACTGACTCCTGTGCCCTCACCAGTGGCAAACCGGAGCCATCCATGAACCAAG TGAACTCTTACGGGCACCCACAA

GCTTCCCATCTCTACCCTGGCCCAGCACCAATGTACCCGATCTCCACCCAAGACTCAGCAGGATACAACCGCCCAG CACACCACATGGTTCCCCGGCCA

CCTGTCCCACCTCCTGGTGCCAATGAGGAGATCACCGATGACTTCGACTGGGACTTGATCACTTAATGAATCACAGTTGACATCAGCCCAAGGCCTGGTG

GTGAATTCTGGCCACGGGGGAAGAGCAGTCCCCGGCTATCCTCCCCAAACCTGTATATAGATATATAGCTTCTTTCTGTTCTCTCTGTCAGAGACGCCAC

CGCAAGATGCTGCCGAGGATAATCCTCTTTTCCTCCTCATCCTTTGTTTCCCTCCTAGTTCATTATTATTCTAATTATATTATTATTATTATTATTGGTT

ACATACTGCCCAGTCTGCTGCCCTCTTACCCTGGGCTTTGCCCTCCCTTTGCCCGTTTGAAATCTTCAGGTCTCAAGATGAGGCCGTGATAGCTGTCAGG

AAAGGCTTCGAATGCTAGTTCACCTTTCTCTCTGAGAAACTCAGTGCTGATCCCACCTTTCAGCTCTGAACTGTGTTCTGTTCCTGTCTGTTTCAGGCTG

GCCTGGAGAGGCCACAGTAAGTAGAGGGGAGGCTAAGACACTGCTTGGCAACCATGACGTTGCAGTTTTACTCAATGGTGCTAATTGTGTCCTCTGCACT

CTCCCATTATACATCCGATCTTTACTTTTTCCGGCAGTCCTCATGCCCATGATGGGTGGACTTGGAGAGCTGGGTTCCGTAGAGCGCCATGGAGCAGTGA

TGGGTATAACCCAGCATGAGGTTGGGTATGCACTGCCATATCAAAACATCCCTGGCTTCTTCCTGGTTGATGCTCTGGGGAGGTTAGCTTGTCCGCTCGG

GCATGAAGACCACTGTGCATCCTAGGTTCAACTTCTTGGAAACAATTTCAATTTAAGGCATTTTGGCTTTGGAAAAGGAATTCTTTCTGAGAGTTAGCTG

GCTATTCTGCATATATAAATGACCTTCCATCATCTCTTCTCCTTCAGCATATACTTTTTTGTCTTCCTAAAGCTGTTTGTCCAAATCATCTACCTGTTTT

ATTTTTTGTTCTCCCATTTTCTGGGAATCTCAAAAGACAAAAGGAAGCCATTCTCACTCCTAGTTTCTTCATGTCATAGACATGCTGTGGAAACCTCTTT

CCCTCCTGTCACAGCAGACTCATACCTGTGATACTGCTGACGGGAGGTTGGGGAGAAGAGAGGGAACTGGCGGAGATGTGGGTGGGAACCTGTCATTTGT

TTAACTGCACAGGGAGACGCTTCTCTTGAAGTCCCTGTCGGTGGGGTGGAAGCTTTTGATTTTGACAGGCAATGAATAATTACATTCCCCTGTAAGAGGG

AGATGAATTATACAGAGACAGGGCGCAGCAAGGGCAAGGCGCACTCCTAGGCACAGAGTGGGGAGTCTCCATTATCAATGAACGGCCATGATTTATTGCT

GCAGAGGTCTTAGTGAGGGTGTGGTTGAATTCGATTCGAGAGAGGGAAATCTCACTTCCACCTTATTTTCACTAAATTTTCTGAAACAGACAAAATGTGT

AGTGTTGACAGGGCCAATCTCCGTGACTTTTGTTCATATGCTTTTATTTATCCATGATTTCCAAGACACTGGGCTTCCCATTCTCACTTCCCCTCATCAA

TCCCTTTCCTTTCTTTAGAAGGGGGCTTATGTATGAGACTGGTGAAGTCCAGTGAAGCTAAGTAAAGGGGCAAGATGGGGCAGTTCACTAAAGAGCACTT

TATTTCTTTGTAAGGAAAAAAAAAGGGAGTATAAGAAAAAGTTTCCTCCAGCAGTGTGCGATGTACTGGAGAGCATCTGGTGGGCCAGTGTATGAAGCAG

TAGTTCCCGCTAGGGAACGGGGTGTTTCCCTAGAGGAGGCACACACCTTTGCCAGGTGCCCTACTAGACATCTCTTGCTATGCCTCCCATCCAGGTGTAG

TCTCCACAGCTTCCCTTTGGTTTCCTCGAGGTCTCTCCCTTGCAGATTACCACCTCTTCTTCTAAGCACCTTTCCTGGTCAGATCTGTCCGCGGTTGGGG

AGCTAGGCTGAGTCATACTCCCAGGTGCCCCGGCTTCTCCATGTCTTGAGAACCAGTCTCCCTGGTGGGCAGCCAGAGCAGCTACAGTGGGCTGGAGACT

GGAGGGTGGCTTTAGGCCCCCTGAGGTTCTAGCTCTCCAGGGTCAGGCTTGCAGAACGGGGCAGTTTAAACCTGATCCCCTCTGGGCCTCCGATTCCCAT

GCCCTCCATGACGTGGAAAGGGAACTACTTTTATTTTGTTGGTCCGGTATTGCTGGACATGAAGTACAGTCCTTGCTGTTGTCTTGGGTGATATTTGCAC

AGTTGTGGGGGTCACTGCCTATAAGAGGAAATAGGGGAGACAGCAGAGGTGCAGGACAAAGGAGAAGTCATTTGTGTTGCTCCACCTATCCTAGGCTTCC

TCTCCTCAACCCCATGTTTCTGGTTTGGTGAGTTCTTTATACCACCCATAATGCTTTGCATTGGTGCAGGCTGGGAAGGGGGTGTATGGGCTCACAACTT

GTTTGGTTTTTTTGTTTTGTTTTGTTTTTGTTTTTGTTTTTTTGCATGCTTTCTT
Translation
  - UNI14435 - - UNI29374 - MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYA

TLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWK NSIRHNLSLNKCFRKVPRPRDDPGK GSYWTIDTCPDISRKRRHPPDDD LSQDSPEQEA

SKSPRGGVPGSGEASLSHEGTPQMSLQSPSSVANYSQ GPGSVDGGAVAAGAPGQESTEGAPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLERSSS

SQHG GFSSLLGDMPPSNNYYVYQQQQQQQPPPQPQPPPQQPQPQQQQAPTQGPSNVGGAPPLHTPSPDGCTTPGGKQAGAEGYGPPTGMAMHPPPLQHG

GYHPHQHHPHSHPAQQPPQPQAQSQASINSTGFA AFPPDWCSNIDSLKESFKMVNRLNWSSIEQSQFSE ELMESLRQAEQRNWTLDQHHIANLCDSLN

HFLTQTGHMPQQGGSHRPPAPSRITDSCALTSGKPEPSMNQV VNSYGHPQASHLYPGPAPMYPISTQDSAGYNRPA AHHMVPRPPVPPPGANEEITDD

FDWDLIT

For any suggestions or comments, please send an email to unitrap@crg.es