Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003199 (Mpnd)
Chromosomal location
Chr 17: 56148640 - 56156082 (+)
Description
MPN domain containing Gene [Source:MGI Symbol;Acc:MGI:1915297]
RefSeq_peptide
NP_080806.4 
UniGene
Mm.358710 
MGI
MGI:1915297 
Uniprot/SWISSPROT
Q3TV65 
Human Ortholog
ENSG00000008382 (MPND)
Omim not available
UniTrap UNI24798
Vector Insertion
Chr 17: 56149010 - 56149699
Public Clones not available
Private Clones OST206190 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097305
Sequence
ATGAGGACGACGCGGAGGCCGAGGACCCCGAGCGCGGGACGGGTAGCGGAGGGCGCA CGGCAGCCTCGGTGGCAGCGGAGGCGGCACGGCAGGGCCTGG

GATGGCCCTAGGGGGCGCGCTCACGAGGCGCGCGGTCAC CTTCGGGTGCTGCTCAAAGACGAGCTGCTGGAGCCCGGTGAGGGGGTGCTATCCATCTAC

TACCTG - UNI24798 - GGCAGGAAGTTTACTGGGGACCTGCAGCTGGATGGCAGGATCGTGTGGCAGGAAACTGGACAAGTCTTCAACTCACCCAG

CGCCTGGGCCACACACTGCAAGAAGCTCGTCAACCCAGCCAAGAAATCTGGCTGTGGCTGGGCCTCTGTCAAGTACAAGGGCCAGAAGCTGGACAAATAC

AAGGCCGCCTGGCTTCGCCGGCACCAGCTACATATGCCTGTAGCTACGGCCGATGAG AGTCCCACCAGTGAAGGGGAGGAGGAAGAACTGCTGTTGGAG

GAGGAGGAAGAAGATGTGCTGGCTGGGGTCTCATCAGAGGACAAAGGCCACAGACCCCCTGGGAAGGGTTCCTTGGAGCCAG AGGCCACACCCCCAGGG

AAGCGTATGGACAAGGTGCCAGTGCCCATCCGTTACTGCATGCTGGGCAGCCGAGACTCCGCCAG GAACCCCCACACTCTGGTAGAAGTAACATCCTTT

GCTGCCATCAACAAGTTCCAGCCATTCAACGTGGCCGTTTCCAGTAATGTGCTGTTCCTCTTG GACTTCCACTGTCACCTGACTCGGAGTGAGGTCGTG

GGCTACCTTGGTGGTCGCTGGGACATCAACAATCAGA TGCTGACCGTGCTGAGAGCCTTCCCCTGCAGGAGTCGGCTGGGGGACACTGATACTGCAGCC

ACGGTTGAGGAGGAG ATCTACCAGGTCCTGTTCCTTCGAGGCCTGTCCCTGGTGGGCTGGTACCACAGCCACCCACACAGCCCTGCAGTACCCTCCTTG

CAGGACATTGACGCACAGATGGAGTACCAGTTGAGACTGCAAGGCTCCAGCAATGGCTTCCAGCCCTGCCTGGCCCTGCTGTGCT CCCCCTACTACTCT

GGCAACCCAGGCCCTGAGTCCAAGATCTGCCCTTTCTGGGTGATGCCTCCCCCTGAG CAAAGGCCCAGTGACTATGGAATCCCCATGGACGTAGAGATG

GCGTATGTCCAAGATAGCTTCTTGACCAACGATGTTCTTCAGGAGATG GTGATGCTGGCTGAGTTCTACAAGGGTGCCCCTGACCTGGTGAAGTTCCAA

GAGGCCTGGAGCCCAGAGCATACCTACCTGGACAAACTCAAG ATGTCCTTGGCCAGCAGGACCCCGAAGGACCAGGGCATGTGCCACGTGCTGGAGCAG

GTCTGCAGTGTGCTCAAGCAGGGGAGCTGA
Translation
MRTTRRPRTPSAGRVAEGA RQPRWQRRRHGRAWDGPRGRAHEARGH LRVLLKDELLEPGEGVLSIYYL - UNI24798 - GRKFTGDLQLDGRIVW

QETGQVFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKAAWLRRHQLHMPVATADE SPTSEGEEEELLLEEEEEDVLAGVSSEDKGHRPPGK

GSLEPE EATPPGKRMDKVPVPIRYCMLGSRDSAR RNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLL DFHCHLTRSEVVGYLGGRWDINNQM MLTV

LRAFPCRSRLGDTDTAATVEEE IYQVLFLRGLSLVGWYHSHPHSPAVPSLQDIDAQMEYQLRLQGSSNGFQPCLALLCS SPYYSGNPGPESKICPFWV

MPPPE QRPSDYGIPMDVEMAYVQDSFLTNDVLQEM VMLAEFYKGAPDLVKFQEAWSPEHTYLDKLK MSLASRTPKDQGMCHVLEQVCSVLKQGS
Transcript ENSMUST00000003267
Sequence
ACTCGGAGGAGGCTGTGCCGGGACACAGCGTCCATGGCAG CTCCCGAGTCTCTGTCTCCCGGGGCCACGGCCGAGGAGGCGCCGGAGGAGGATGAGGAC

GACGCGGAGGCCGAGGACCCCGAGCGCGGGACGGGTAGCGGAGGGCGCAGCGGCAGCCTCGGTGGCAGCGGAGGCGGCACGGCAGGGCCTGGGATGGCCC

TAGGGGGCGCGCTCACGAGGCGCGCGGTCACGCTTCGGGTGCTGCTCAAAGACGAGCTGCTGGAGCCCGGTGAGGGGGTGCTATCCATCTACTACCTG -

 UNI24798 - GGCAGGAAGTTTACTGGGGACCTGCAGCTGGATGGCAGGATCGTGTGGCAGGAAACTGGACAAGTCTTCAACTCACCCAGCGCCTGGG

CCACACACTGCAAGAAGCTCGTCAACCCAGCCAAGAAATCTGGCTGTGGCTGGGCCTCTGTCAAGTACAAGGGCCAGAAGCTGGACAAATACAAGGCCGC

CTGGCTTCGCCGGCACCAGCTACATATGCCTGTAGCTACGGCCGATGAG AGTCCCACCAGTGAAGGGGAGGAGGAAGAACTGCTGTTGGAGGAGGAGGA

AGAAGATGTGCTGGCTGGGGTCTCATCAGAGGACAAAGGCCACAGACCCCCTGGGAAGGGTTCCTTGGAGCCAG AGGCCACACCCCCAGGGAAGCGTAT

GGACAAGGTGCCAGTGCCCATCCGTTACTGCATGCTGGGCAGCCGAGACTCCGCCAG GAACCCCCACACTCTGGTAGAAGTAACATCCTTTGCTGCCAT

CAACAAGTTCCAGCCATTCAACGTGGCCGTTTCCAGTAATGTGCTGTTCCTCTTG GACTTCCACTGTCACCTGACTCGGAGTGAGGTCGTGGGCTACCT

TGGTGGTCGCTGGGACATCAACAATCAGA TGCTGACCGTGCTGAGAGCCTTCCCCTGCAGGAGTCGGCTGGGGGACACTGATACTGCAGCCACGGTTGA

GGAGGAG ATCTACCAGGTCCTGTTCCTTCGAGGCCTGTCCCTGGTGGGCTGGTACCACAGCCACCCACACAGCCCTGCAGTACCCTCCTTGCAGGACAT

TGACGCACAGATGGAGTACCAGTTGAGACTGCAAGGCTCCAGCAATGGCTTCCAGCCCTGCCTGGCCCTGCTGTGCT CCCCCTACTACTCTGGCAACCC

AGGCCCTGAGTCCAAGATCTGCCCTTTCTGGGTGATGCCTCCCCCTGAG CAAAGGCCCAGTGACTATGGAATCCCCATGGACGTAGAGATGGCGTATGT

CCAAGATAGCTTCTTGACCAACGATGTTCTTCAGGAGATG GTGATGCTGGCTGAGTTCTACAAGGGTGCCCCTGACCTGGTGAAGTTCCAAGAGGCCTG

GAGCCCAGAGCATACCTACCTGGACAAACTCAAG ATGTCCTTGGCCAGCAGGACCCCGAAGGACCAGGGCATGTGCCACGTGCTGGAGCAGGTCTGCAG

TGTGCTCAAGCAGGGGAGCTGAGGCTGCATAGGCTTTGCTGTCCTGGGACAGGCTGGGTAATAAAGTCTCTGAGTGCCC
Translation
 MALGGALTRRAVTLRVLLKDELLEPGEGVLSIYYL - UNI24798 - GRKFTGDLQLDGRIVWQETGQVFNSPSAWATHCKKLVNPAKKSGCGWASV

KYKGQKLDKYKAAWLRRHQLHMPVATADE SPTSEGEEEELLLEEEEEDVLAGVSSEDKGHRPPGKGSLEPE EATPPGKRMDKVPVPIRYCMLGSRDSA

R RNPHTLVEVTSFAAINKFQPFNVAVSSNVLFLL DFHCHLTRSEVVGYLGGRWDINNQM MLTVLRAFPCRSRLGDTDTAATVEEE IYQVLFLRGLS

LVGWYHSHPHSPAVPSLQDIDAQMEYQLRLQGSSNGFQPCLALLCS SPYYSGNPGPESKICPFWVMPPPE QRPSDYGIPMDVEMAYVQDSFLTNDVLQ

EM VMLAEFYKGAPDLVKFQEAWSPEHTYLDKLK MSLASRTPKDQGMCHVLEQVCSVLKQGS

For any suggestions or comments, please send an email to unitrap@crg.es