Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003208 (Ccdc94)
Chromosomal location
Chr 17: 56098597 - 56107704 (+)
Description
coiled-coil domain containing 94 Gene [Source:MGI Symbol;Acc:MGI:1920136]
RefSeq_dna
NM_028381 
RefSeq_peptide
NP_082657.1 
UniGene
Mm.371679 
MGI
MGI:1920136 
Uniprot/SWISSPROT
Q9D6J3 
Human Ortholog
ENSG00000105248 (CCDC94)
Omim not available
UniTrap UNI1012
Vector Insertion
Chr 17: 56098685 - 56100135
Public Clones AL0080 (sanger) (sanger) AZ0060 (sanger) RRK327 (baygenomics) RRK129 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7470
Vector Insertion
Chr 17: 56101587 - 56103552
Public Clones RRG033 (baygenomics) RRM285 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086869
Sequence
ATCGGAGAAACTCCCCGTAGACTGAGGACCGCTTCTTCGCTTGTTCGCTGGACAGGAAGCGAAAATGTCGGAACGGAAAGTTTTAAAC - UNI1012 -

 AAATACTACCCACCTGACTTTGACCCATCGAAGATCCCGAAACTCAAGCTACCCAAGGACCGGCAGTATGTGGTGCGTCTGATGGCCCCCTTCAACATG

AG GTGTAAGACGTGTGGAGAATACATCTACAAGGGGAAGAAGTTCAATGCACGAAAGGAAACAGTCCAGAACGAGGCTTACCTGGGCCTGCCAATCTTC

CGATTCTACATCAAGTGCACGCGCTGCTTGGCCGAGATCACCTTCAAG - UNI7470 - ACGGACCCAGAGAACACGGACTACACCATGGAGCACGGG

GCCACGCGCAACTTCCAGGCGGAGAAGCTTCTGGAGGAGGAGGAGAAGCGCGTGCAGAAGGAGCGAGAGGATGAGGAACTGAACAACCCCATGAAG GTC

CTAGAGAACCGGACGAAGGACTCCAAGCTGGAGATGGAAGTGCTGGAAAACCTGCAAGAGCTGAAAGACCTGAACCAGCGGCAGGCGCATGTGGACTTTG

AGGCCATGCTGCGGCAGCACCGCATGTCTCAGGAGCAGTGGCAGCAGCAGCAGGAGGAGGAAGACGAGCGGGAGACAGC GGCCTTGCTGGAGGAGGCTC

GCCATCGAAGGCTTCTGGAGGACTCTGAGTCAGAGGATGAGGCGCCACCTTCCCGACCACGGGCAGCTGCAAGACCCAACCCCACAGCCATCCTCAACGA

G GTACCGCAGACCAAGAGGAAGGCAGAGGCCCTGTGCAGTAAAGCACAGTTGGCAGGCTTAGTTGTACCAAAGAAGGTAAAGACAGAAGCCAACGGCGC

CTCAGAGCAGGTCGGGGTGCCCACCGCCGCAG GTGCCCCCAAGAGCAGGAAGGCGGACAACCCTACACCCCAGACACCTGGCACGTCCTCCCTGAGCCA

GCTGGGTGCATATGGGGACAGCGAGGACAGCGACAGCTGAGTGTCAGTGATGCCCACCGTGGTCTCATAGACCCAAGAAATGAGGAGGAGATGGGATCAA

GCAAGCACCTTCAGCAAAGGCCTCGGGACCATCTCTGCCATGGCCTGGCAGTGTACGGAGAAGCAGTGTCCCCAGGCACCCCAGGACAGACAGCCTGGCC

CTCTCCTTCAGTCCTTGAGTTGTGTGGAGCCTGTTGGCCGGTCCCTTCCTGCCACAGATCAGAACACAGTCTGACTTGGGGGGGGGGGGCAGGGACCCTA

TCTCCCTAGCACCATCTCCCAACAATACACAAGGCCTGGGGCTCCATCCGAATGCAACACAGTCGTGCTGTTTAAACAAAACAAGAAGAAAGAATAGAAA

GTCAGTTGAGAACCTGCCTGGCTGCAGGGGCTACCCCAGGGTTAACACCTCGGATTTCTGCCATACACCCCTGCGCCTGGCCTCTCAGCATGGCCTTCAT

GCAGAATTTGGGATTACATCAGTCTGTGTTCTGATACTGTAAGGAAGCAATGTTGAGGCTGAATCTGTTCTGTAGAAAGAAGTGAGCCAGGCACAGTGTG

GAGGTAGAGAAGCAGGCGTATGTAGCCACACTCTCGCCTCACCAGTGCTGGGATCAGAGACTGAACCACCAAACTGATCTTAAACCG
Translation
MSERKVLN - UNI1012 - KYYPPDFDPSKIPKLKLPKDRQYVVRLMAPFNMR RCKTCGEYIYKGKKFNARKETVQNEAYLGLPIFRFYIKCTRCLA

EITFK - UNI7470 - TDPENTDYTMEHGATRNFQAEKLLEEEEKRVQKEREDEELNNPMK VLENRTKDSKLEMEVLENLQELKDLNQRQAHVDFEA

MLRQHRMSQEQWQQQQEEEDERETA AALLEEARHRRLLEDSESEDEAPPSRPRAAARPNPTAILNE VPQTKRKAEALCSKAQLAGLVVPKKVKTEANG

ASEQVGVPTAAG GAPKSRKADNPTPQTPGTSSLSQLGAYGDSEDSDS

For any suggestions or comments, please send an email to unitrap@crg.es