Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003233 (Dvl3)
Chromosomal location
Chr 16: 20517137 - 20531589 (+)
Description
dishevelled 3, dsh homolog (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:108100]
RefSeq_dna
NM_007889 
RefSeq_peptide
NP_031915.2 
UniGene
Mm.247259 
MGI
MGI:108100 
Uniprot/SWISSPROT
Q61062 
Human Ortholog
not available
Omim not available
UniTrap UNI36298
Vector Insertion
Chr 16: 20517429 - 20522328
Public Clones IST14972B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34946
Vector Insertion
Chr 16: 20525852 - 20525978
Public Clones IST13317F1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003318
Sequence
AAGGGAGCTGGCGGCCCGGCCGGCGGCTGAGTGGGGCTGAGCAGCGGGCCGCGCCGAGCGCCGAGCTCTGCCGGAGAGGCCCGGCCCCGCTGCCCAAGCA

GGCCGCGCGCCGCGGGGCCGAGGCCGGAGCCATGGGCGAGACCAAGATCATCTACCACCTGGACGGCCAGGAGACGCCGTACCTGGTGAAGCTGCCCCTG

CCCGCCGAGCGCGTCACCTTGGCGGACTTTAAGGGCGTTCTGCAGCGGCCCAGCTATAAGTTCTTCTTCAAGTCTATGGACGACGATTTTGG GGTGGTG

AAGGAAGAGATCTCGGACGACAATGCCAAGCTACCCTGCTTCAATGGCCGGGTGGTGTCCTGG CTGGTATCTGCCGAGGGCTCACACCCAGAGCCGGCC

CCTTTCTGTGCTGACAACCCGTCAGAGCTGCCACCTTCGATGGAACGCACAGGAGGCATTGGGGACTCTCGACCCCCCTCCTTCCA CCCTCATGCTAGT

GGGGGCAGCCAGGAGAATCTGGACAATGACACGGAGACCGACTCCTTGGTGTCTGCCCAACGAGAGCGGCCCCGACGGAGGGATGGCCCGGAGCACG CA

GCCCGACTCAATGGAACCACAAAGGGTGAGCGGCGACGGGAGCCAGGCGGCTATGACAGTTCATCTACCCTCATGAGCAGCGAGCTGGAGACTACCAGTT

TCTTTGATTCCGATGAGGATGATTCCACCAGCAG GTTCAGCAGCTCCACAGAACAGAGCAGTGCCTCACGCCTCATGAGAAGACACAAGCGGCGGCGGC

GGAAGCAGAAGGTCTCCCGGATTGAGCGG TCCTCGTCTTTCAGCAGCATCACAGACTCCACTATGTCTCTCAACATCATCACCGTCACTCTCAACATGG

 AAAAGTATAACTTCTTGGGCATCTCCATTGTGGGCCAAAGCAATGAGCGAGGTGATGGGGGCATCTACATTGGCTCCATCATGAAGGGTGGGGCTGTGG

CAGCTGATGGACGCATTGAGCCAGGAGATATGCTACTGCAG - UNI34946 - GTAAATGAGATCAACTTCGAGAACATGAGCAACGATGACGCAGTC

CGAGTCCTTCGGGAGATTGTGCACAAGCCAGG GCCCATCACTCTGACTGTAGCCAAGTGCTGGGACCCAAGTCCTCGCGGCTGCTTCACATTACCCCGG

A GCGAGCCCATCCGTCCCATTGACCCTGCAGCCTGGGTCTCTCACACGGCAGCCATGACAGGCACCTTCCCCGCCTATGGCATGAGCCCCTCCTTAAGC

ACCATCACCTCTACCAGCTCCTCCATCACCAGCTCCATCCCTGATACAGAGC GCCTAGATGATTTCCACCTCTCCATCCACAGTGACATGGCGGCCATC

GTAAAAGCCATGGCCTCCCCTGAGTCAGGGTTGGAGGTCCGAGACCGCATGTGGCTCAAGATTACCATTCCCAATGCTTTCATCG GCTCGGATGTGGTG

GACTGGCTGTACCACAACGTGGAAGGGTTCACCGACCGTCGGGAGGCCCGCAAGTATGCTAGCAACCTGCTGAAAGCTGGTTTCATCCGCCATACCGTCA

ACAAGATCACGTTCTCCGAGCAGTGCTACTACATCTTTGGCGACCTCTGTGGTA ACATGGCCAACCTATCGCTTCACGACCATGATGGCTCCAGTGGCG

CCTCTGACCAGGACACACTGGCTCCTTTGCCGCACCCAGGAGCTGCCCCTTGGCCTATGGCTTTCCCTTACCAGTACCCACCACCTCCGCATCCCTACAA

CCCACACCCAGGCTTCCCAGAACTGGGCTACAGCTACGGTGGGGGCAGCGCCAGCAGTCAGCACAGTGAAG GCAGTCGGAGCAGTGGCTCCAACCGAAG

TGGCAGCGACCGGCGCAAGGAGAAGGACCCAAAAGCTGGGGACTCCAAGTCAGGTGGTAGCGGCAGCGAGTCAGACCACACTACACGCAGCAGTCTGAGG

GGGCCACGGGAGCGGGCACCAAGCGAGCGATCAGGCCCAGCGGCCAGCGAGCACAGCCACCGCAGTCACCATTCGCTGACCAGCAGCCTGCGCAGCCACC

ACACACACCCAAGCTATGGCCCACCCGGAGTGCCCCCTCTCTATGGTCCCCCGATGCTGATGATGACCCCGCCGCCGGCAGCCATGGGTCCCCCAGGAGC

CCCTCCAGGGCGTGACCTGGCCTCGGTGCCCCCGGAACTGACGGCCAGCAGACAGTCCTTCCGCATGGCAATGGGAAACCCCAGTGAGTTCTTTGTGGAT

GTGATGTGA
Translation
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFG GVVKEEISDDNAKLPCFNGRVVSW LVSAEGSHPEPAPFCADNPS

ELPPSMERTGGIGDSRPPSFH HPHASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHA AARLNGTTKGERRREPGGYDSSSTLMSSELETTSFFDSD

EDDSTSR RFSSSTEQSSASRLMRRHKRRRRKQKVSRIER SSSFSSITDSTMSLNIITVTLNME EKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVA

ADGRIEPGDMLLQ - UNI34946 - VNEINFENMSNDDAVRVLREIVHKPG GPITLTVAKCWDPSPRGCFTLPRS SEPIRPIDPAAWVSHTAAMTG

TFPAYGMSPSLSTITSTSSSITSSIPDTER RLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWLKITIPNAFIG GSDVVDWLYHNVEGFTDRREARK

YASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGN NMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPHPGFPELGYSYGGGS

ASSQHSEG GSRSSGSNRSGSDRRKEKDPKAGDSKSGGSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPGVPPLY

GPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM

For any suggestions or comments, please send an email to unitrap@crg.es