Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003269 (Pscd2)
Chromosomal location
Chr 7: 53062009 - 53069683 (-)
Description
cytohesin 2 Gene [Source:MGI (curated);Acc:Pscd2-001]
RefSeq_peptide
NP_001106171.1 NP_035311.1 
UniGene
Mm.272130 Mm.400643 
MGI
MGI:1334255 
Uniprot/SWISSPROT
P63034 
Uniprot/SPTREMBL
Q99KH2 Q5HZZ0 
Human Ortholog
ENSG00000105443 (CYTH2)
Omim not available
UniTrap UNI11774
Vector Insertion
Chr 7: 53069249 - 53069467
Public Clones E122C07 (ggtc) D153C08 (ggtc) (ggtc) A050B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16759
Vector Insertion
Chr 7: 53068378 - 53068527
Public Clones not available
Private Clones OST454810 (lexicon) OST422644 (lexicon) OST117537 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20176
Vector Insertion
Chr 7: 53068284 - 53068378
Public Clones not available
Private Clones OST370063 (lexicon) OST95014 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8506
Vector Insertion
Chr 7: 53067669 - 53068216
Public Clones RRO229 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107726
Sequence
TGGCTTTCTTCCTGCGGACCTAGGCTTAACGCCGTCCTTTCCGACCCTGACCCAGGGTCCTGCTGCCGTAGCTTGTTTCTACTGTGTACCCCAGATCCAG

GCCACGTTGTCCGCTATGGCGGAACCAGAACCTCGTTTCTTTTCCAAGAAATGCACCCAAGATTCAGGACCCCCAACTTTCCCATCATGATGGAGCCAGA

ATCTGGCCCCCTTACGAGAAATGCACCCCAGGTTCATGCTAGGATCCCTACAGTGGTGGATCCAGAAGCCAGAGTCCTGGTGTCTTTCCAAGATTTGCAT

CCGAGATCTAGGACCCCAAAGCCCTTTTGATGATGAAGCCATGAGTCCAAGGCCCTGTGTCCTTCCAAGTAATGTTTCCAATATCCAAGCATCCTGTTCT

ACTGTGTTGGGACCAAGGAGCCAGGGCTTCCAAATAAAGCATCTAAAATTCAGACTCAGGAGTTTCTAATTGTGGTGATGGGTCCAGAATCCCAGGGACT

GGTTGCCTTTCAAGTAATTGGCCCAGAAATTCATCCTCAGACCTATGAGCTGGGATTCCTAGGCACTTCTGACACAAACTCAGGACTCAGTTTTACTCCC

TCTCCTCAGACTTCTGGTACCCATTCCTCTTCTGGACAGGAATCCAGGCCCCCAGCCCAAATCCTTTCTCAGGATGCAGGAGTCCTGACCCCCAGAACTA

ATTTCTTGACCCTGGTCCCCAGAGCCCCCAGACTTGACTCCAGAGGAGCGCATGGAGTTGGAGAACATCCGGCGGCGCAAGCAGGAGCTGCTGGTGGAGA

TCCAGCGCCTGCGAGAAGAGCTAAGTGAAGCTATGAGCGAGGTGGAGGGTCTGGAGGCCAATGAGGGCAG - UNI16759 - - UNI20176 - TAA

GACCTTGCAGCGGAACCGGAAGATGGCAATGGGCAGGAAGAAATTCAACATGGACCCCAAAAAG - UNI8506 - GGGATCCAATTCTTGGTGGAGCA

TGAACTTCTGCAGAACACGCCTGAGGAAATTGCCCGCTTCCTGTACAAGGGCGAGGGGCTGAACAAGACAGCCATTGGGGACTACCTAGGGGAAAG GGA

AGAGCTGAACCTGTCTGTGCTCCATGCTTTTGTGGATCTCCATGAGTTCACCGACCTCAACCTGGTGCAGGCCCTCCG GCAATTCCTATGGAGCTTTCG

CCTCCCTGGAGAGGCTCAGAAAATTGATCGAATGATGGAGGCCTTTGCCCAGAGATACTGCTTATGCAACCCTGGGGTCTTCCAGTCTACAG ACACCTG

CTACGTGTTGTCCTTTGCCGTGATCATGCTGAACACCAGCCTTCACAATCCCAATGTCAGGGACAAGCCGGGCCTGGAGCGCTTTGTGGCCATGAACCGG

GGCATCAACGAGGGTGGGGATCTGCCTGAGGATCTTCTCAGG AACCTCTACGACAGCATCCGGAACGAGCCCTTCAAAATCCCAGAGGATGATGGGAAT

GATCTCACCCACACCTTCTTCAACCCAGACCGAGAGGGCTGGCTCCTAAAGCTGG GGGGCCGGGTGAAGACTTGGAAGCGGCGCTGGTTCATCCTTACA

GACAACTGCCTCTACTACTTTGAATACACTACG GACAAGGAGCCCCGAGGGATTATCCCCCTAGAGAACCTGAGCATCCGGGAGGTGGACGATCCTCGG

AAGCCG AACTGCTTTGAGCTTTACATTCCCAACAATAAGGGACAGCTCATCAAAGCCTGCAAAACAGAGGCTGACGGCCGGGTAGTGGAGGGGAACCAC

ATGGTGTACCGAATCTCAGCACCCACCCAGGAGGAGAAAGATGAGTGGATCAAATCCATCCA GGCTGCTGTAAGTGTGGACCCCTTCTATGAGATGTTG

GCAGCAAGAAAGAAGCGAATTTCTGTGAAGAAGAAGCAAGAACAACCCTGACCCCTGTCCCCAACTCCATTATTTATTTTGGAGCTGCCCCGCCTGGGTG

GCAGGACCCCTGGGCCCTGGGGCTGTGGATC
Translation
MELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGS - UNI16759 - - UNI20176 - SKTLQRNRKMAMGRKKFNMDPKK - UNI8506

 - GIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGER REELNLSVLHAFVDLHEFTDLNLVQALR RQFLWSFRLPGEAQKIDRMMEAFAQRY

CLCNPGVFQSTD DTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLR NLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLK

LG GGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSIREVDDPRKP NCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKD

EWIKSIQ QAAVSVDPFYEMLAARKKRISVKKKQEQP
Transcript ENSMUST00000107728
Sequence
GTTGGGCCGTGAAGGGAGAGTCTTTTCGGCGCTGAGGACGGGCGCTGAGGAGGCGGCGGTGGCTCCTGGGGCGTTTGAGCGGGCTCACTCGAGCCCGCGG

GCCGACGCGGACGCAGGCCCAGCCGGCGGAACCGCCCCGGACTCCCCGCGGGCCTTCCTAGCCGCCATGGAGGACGGTGTCTACG - UNI11774 - -

 UNI16759 - AGCCCCCAGACTTGACTCCAGAGGAGCGCATGGAGTTGGAGAACATCCGGCGGCGCAAGCAGGAGCTGCTGGTGGAGATCCAGCGCCT

GCGAGAAGAGCTAAGTGAAGCTATGAGCGAGGTGGAGGGTCTGGAGGCCAATGAGGGCAG - UNI16759 - - UNI20176 - TAAGACCTTGCAG

CGGAACCGGAAGATGGCAATGGGCAGGAAGAAATTCAACATGGACCCCAAAAAG - UNI8506 - GGGATCCAATTCTTGGTGGAGCATGAACTTCTG

CAGAACACGCCTGAGGAAATTGCCCGCTTCCTGTACAAGGGCGAGGGGCTGAACAAGACAGCCATTGGGGACTACCTAGGGGAAAG GGAAGAGCTGAAC

CTGTCTGTGCTCCATGCTTTTGTGGATCTCCATGAGTTCACCGACCTCAACCTGGTGCAGGCCCTCCG GCAATTCCTATGGAGCTTTCGCCTCCCTGGA

GAGGCTCAGAAAATTGATCGAATGATGGAGGCCTTTGCCCAGAGATACTGCTTATGCAACCCTGGGGTCTTCCAGTCTACAG ACACCTGCTACGTGTTG

TCCTTTGCCGTGATCATGCTGAACACCAGCCTTCACAATCCCAATGTCAGGGACAAGCCGGGCCTGGAGCGCTTTGTGGCCATGAACCGGGGCATCAACG

AGGGTGGGGATCTGCCTGAGGATCTTCTCAGG AACCTCTACGACAGCATCCGGAACGAGCCCTTCAAAATCCCAGAGGATGATGGGAATGATCTCACCC

ACACCTTCTTCAACCCAGACCGAGAGGGCTGGCTCCTAAAGCTGGGTAC CCCGGCCCCTCCCACCCCTTCCCTTGCAGGGGGCCGGGTGAAGACTTGGA

AGCGGCGCTGGTTCATCCTTACAGACAACTGCCTCTACTACTTTGAATACACTACG GACAAGGAGCCCCGAGGGATTATCCCCCTAGAGAACCTGAGCA

TCCGGGAGGTGGACGATCCTCGGAAGCCG AACTGCTTTGAGCTTTACATTCCCAACAATAAGGGACAGCTCATCAAAGCCTGCAAAACAGAGGCTGACG

GCCGGGTAGTGGAGGGGAACCACATGGTGTACCGAATCTCAGCACCCACCCAGGAGGAGAAAGATGAGTGGATCAAATCCATCCA GGCTGCTGTAAGTG

TGGACCCCTTCTATGAGATGTTGGCAGCAAGAAAGAAGCGAATTTCTGTGAAGAAGAAGCAAGAACAACCCTGACCCCTGTCCCCAACTCCATTATTTAT

TTTGGAGCTGCCCCGCCTGGGTGGCAGGACCCCTGGGCCCTGGGGCTGTGGATCCTGGTTCCCCATTTGGAAAATCACCACCTCTA
Translation
MEDGVYE - UNI11774 - - UNI16759 - EPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGS - UNI16759 - - 

UNI20176 - SKTLQRNRKMAMGRKKFNMDPKK - UNI8506 - GIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGER REELNLSVLHAF

VDLHEFTDLNLVQALR RQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTD DTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGD

LPEDLLR NLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGT TPAPPTPSLAGGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSI

REVDDPRKP NCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQ QAAVSVDPFYEMLAARKKRISVKKKQEQP
Transcript ENSMUST00000107729
Sequence
AGCAAGGGGCGGGCCCCACCGGCCGGGCGGTTGGGCCGTGAAGGGAGAGTCTTTTCGGCGCTGAGGACGGGCGCTGAGGAGGCGGCGGTGGCTCCTGGGG

CGTTTGAGCGGGCTCACTCGAGCCCGCGGGCCGACGCGGACGCAGGCCCAGCCGGCGGAACCGCCCCGGACTCCCCGCGGGCCTTCCTAGCCGCCATGGA

GGACGGTGTCTACG - UNI11774 - - UNI16759 - AGCCCCCAGACTTGACTCCAGAGGAGCGCATGGAGTTGGAGAACATCCGGCGGCGCAAG

CAGGAGCTGCTGGTGGAGATCCAGCGCCTGCGAGAAGAGCTAAGTGAAGCTATGAGCGAGGTGGAGGGTCTGGAGGCCAATGAGGGCAG - UNI16759

 - - UNI20176 - TAAGACCTTGCAGCGGAACCGGAAGATGGCAATGGGCAGGAAGAAATTCAACATGGACCCCAAAAAG - UNI8506 - GGGA

TCCAATTCTTGGTGGAGCATGAACTTCTGCAGAACACGCCTGAGGAAATTGCCCGCTTCCTGTACAAGGGCGAGGGGCTGAACAAGACAGCCATTGGGGA

CTACCTAGGGGAAAG GGAAGAGCTGAACCTGTCTGTGCTCCATGCTTTTGTGGATCTCCATGAGTTCACCGACCTCAACCTGGTGCAGGCCCTCCG GC

AATTCCTATGGAGCTTTCGCCTCCCTGGAGAGGCTCAGAAAATTGATCGAATGATGGAGGCCTTTGCCCAGAGATACTGCTTATGCAACCCTGGGGTCTT

CCAGTCTACAG ACACCTGCTACGTGTTGTCCTTTGCCGTGATCATGCTGAACACCAGCCTTCACAATCCCAATGTCAGGGACAAGCCGGGCCTGGAGCG

CTTTGTGGCCATGAACCGGGGCATCAACGAGGGTGGGGATCTGCCTGAGGATCTTCTCAGG AACCTCTACGACAGCATCCGGAACGAGCCCTTCAAAAT

CCCAGAGGATGATGGGAATGATCTCACCCACACCTTCTTCAACCCAGACCGAGAGGGCTGGCTCCTAAAGCTGG GGGGCCGGGTGAAGACTTGGAAGCG

GCGCTGGTTCATCCTTACAGACAACTGCCTCTACTACTTTGAATACACTACG GACAAGGAGCCCCGAGGGATTATCCCCCTAGAGAACCTGAGCATCCG

GGAGGTGGACGATCCTCGGAAGCCG AACTGCTTTGAGCTTTACATTCCCAACAATAAGGGACAGCTCATCAAAGCCTGCAAAACAGAGGCTGACGGCCG

GGTAGTGGAGGGGAACCACATGGTGTACCGAATCTCAGCACCCACCCAGGAGGAGAAAGATGAGTGGATCAAATCCATCCA GGCTGCTGTAAGTGTGGA

CCCCTTCTATGAGATGTTGGCAGCAAGAAAGAAGCGAATTTCTGTGAAGAAGAAGCAAGAACAACCCTGACCCCTGTCCCCAACTCCATTATTTATTTTG

GAGCTGCCCCGCCTGGGTGGCAGGACCCCTGGGCCCTGGGGCTGTGGATCCTGGTTCCCCATTTGGAAAATCACCACCTCTAGCTCCTGACTCCTTATTT

GTAATTAACATGTTGGTAATCTTATTAATTATTTAATCCCTTGCGCCTGCAGATGCCCTCATTTCTTGGGTTTGGGAGAGCTGAGGACCCATCCCCTTGA

CATTTACCAGGATGCTGGGCTGCATATAGGGTGCAGACAGGCACATCCCAGACAAGTCACTCAAGCCCTGTGGGTGCTGAGTGCAGAGAGAGTTTACTGT

CTCAGTGTGGTATTTAGGCACAGCATACTCTCCATGTGCTCTGCCCACCATGTTAATGTTGGACCTGTGCTCATTGGAGACCTAGCCTAGCACAGGAGAC

TAAGACTAAAACAACAAAGGACTGGCTCAGGAGGGAGCAAGTCCTGAGAAGGCCCCGAGTCGGTCACTAGGAACTGGCTGTGCTGTCCATGAGTACCCCA

GAGTGTACTAGAGGAGGGGGCACAGCGCTATCAGGAGGTACCTGGGATGCCATTGTGACAGTGGCCTCTTCTAACCCCAGATCTAGCCTCCTGTGGAGGT

GTGTGTTTCTGACTCATGAGAGGGGATCTCGGTGAAGGAATAATGCAGAGACCCCAATGGTCTTGTGCTCCTGTGCTGCTGGGGGAATAGTCTGCCCACA

TTTAGCCTGGAAGCTTTTTTGTTACTCTTCCTGGCCTGTGGTGAGCTTAAAGTCTGAATCCTGCCTGCTTCTTCCCAGCATGCTTTAGCATGCAGGCTTG

ACTGGGAAGAATGAATGCTGTCCCGGAGCCTTCTGGGAATTAAGATTCCAGAACGTGTGTATTGGATTTGCAAACCCCTGTGGGTGTGTACCCCAACAGC

ACTGATCTGGGTAAGGGGGAGCATCCAGGCTCTATTTTAGGTGGGCTTTGGCTCAGGCTACGTGTCAATAGACAGTGGCAGTCTTCACAGTGGCCGTCTT

GTCTCCTAGGAAAAGGTCATGAATTACTATTCCCCTGCCCCCAGGGGCTGCTGTGAAATGGAGATTCCCAAATAAAACAACATGAGTGTCAC
Translation
MEDGVYE - UNI11774 - - UNI16759 - EPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGS - UNI16759 - - 

UNI20176 - SKTLQRNRKMAMGRKKFNMDPKK - UNI8506 - GIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGER REELNLSVLHAF

VDLHEFTDLNLVQALR RQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTD DTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGD

LPEDLLR NLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLG GGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSIREVDDPRKP N

CFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQ QAAVSVDPFYEMLAARKKRISVKKKQEQP
Transcript ENSMUST00000056820
Sequence
AAAGCAAGGGGCGGGCCCCACCGGCCGGGCGGTTGGGCCGTGAAGGGAGAGTCTTTTCGGCGCTGAGGACGGGCGCTGAGGAGGCGGCGGTGGCTCCTGG

GGCGTTTGAGCGGGCTCACTCGAGCCCGCGGGCCGACGCGGACGCAGGCCCAGCCGGCGGAACCGCCCCGGACTCCCCGCGGGCCTTCCTAGCCGCCATG

GAGGACGGTGTCTACG - UNI11774 - - UNI16759 - AGCCCCCAGACTTGACTCCAGAGGAGCGCATGGAGTTGGAGAACATCCGGCGGCGCA

AGCAGGAGCTGCTGGTGGAGATCCAGCGCCTGCGAGAAGAGCTAAGTGAAGCTATGAGCGAGGTGGAGGGTCTGGAGGCCAATGAGGGCAG - UNI167

59 - - UNI20176 - TAAGACCTTGCAGCGGAACCGGAAGATGGCAATGGGCAGGAAGAAATTCAACATGGACCCCAAAAAG - UNI8506 - GG

GATCCAATTCTTGGTGGAGCATGAACTTCTGCAGAACACGCCTGAGGAAATTGCCCGCTTCCTGTACAAGGGCGAGGGGCTGAACAAGACAGCCATTGGG

GACTACCTAGGGGAAAG GGAAGAGCTGAACCTGTCTGTGCTCCATGCTTTTGTGGATCTCCATGAGTTCACCGACCTCAACCTGGTGCAGGCCCTCCG 

GCAATTCCTATGGAGCTTTCGCCTCCCTGGAGAGGCTCAGAAAATTGATCGAATGATGGAGGCCTTTGCCCAGAGATACTGCTTATGCAACCCTGGGGTC

TTCCAGTCTACAG ACACCTGCTACGTGTTGTCCTTTGCCGTGATCATGCTGAACACCAGCCTTCACAATCCCAATGTCAGGGACAAGCCGGGCCTGGAG

CGCTTTGTGGCCATGAACCGGGGCATCAACGAGGGTGGGGATCTGCCTGAGGATCTTCTCAGG AACCTCTACGACAGCATCCGGAACGAGCCCTTCAAA

ATCCCAGAGGATGATGGGAATGATCTCACCCACACCTTCTTCAACCCAGACCGAGAGGGCTGGCTCCTAAAGCTGG CAGGGGGCCGGGTGAAGACTTGG

AAGCGGCGCTGGTTCATCCTTACAGACAACTGCCTCTACTACTTTGAATACACTACG GACAAGGAGCCCCGAGGGATTATCCCCCTAGAGAACCTGAGC

ATCCGGGAGGTGGACGATCCTCGGAAGCCG AACTGCTTTGAGCTTTACATTCCCAACAATAAGGGACAGCTCATCAAAGCCTGCAAAACAGAGGCTGAC

GGCCGGGTAGTGGAGGGGAACCACATGGTGTACCGAATCTCAGCACCCACCCAGGAGGAGAAAGATGAGTGGATCAAATCCATCCA GGCTGCTGTAAGT

GTGGACCCCTTCTATGAGATGTTGGCAGCAAGAAAGAAGCGAATTTCTGTGAAGAAGAAGCAAGAACAACCCTGACCCCTGTCCCCAACTCCATTATTTA

TTTTGGAGCTGCCCCGCCTGGGTGGCAGGACCCCTGGGCCCTGGGGCTGTGGATCCTGGTTCCCCATTTGGAAAATCACCACCTCTAGCTCCTGACTCCT

TATTTGTAATTAACATGTTGGTAATCTTATTAATTATTTAATCCCTTG
Translation
MEDGVYE - UNI11774 - - UNI16759 - EPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGS - UNI16759 - - 

UNI20176 - SKTLQRNRKMAMGRKKFNMDPKK - UNI8506 - GIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGER REELNLSVLHAF

VDLHEFTDLNLVQALR RQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTD DTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGD

LPEDLLR NLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLA AGGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSIREVDDPRKP 

NCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQ QAAVSVDPFYEMLAARKKRISVKKKQEQP

For any suggestions or comments, please send an email to unitrap@crg.es