Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003279 (Dlgap1)
Chromosomal location
Chr 17: 70318586 - 71169064 (+)
Description
discs, large (Drosophila) homolog-associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:1346065]
RefSeq_dna
NM_177639 
RefSeq_peptide
NP_001121653.1 NP_081988.3 NP_001121652.1 NP_808307.2 
UniGene
Mm.396827 
MGI
MGI:1346065 
Uniprot/SWISSPROT
Q9D415 
Uniprot/SPTREMBL
Q3UVU8 Q3TQC6 Q3TSN1 Q3UHD8 
Human Ortholog
ENSG00000170579 (DLGAP1)
Omim not available
UniTrap UNI34268
Vector Insertion
Chr 17: 70427764 - 70555576
Public Clones IST14232C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38300
Vector Insertion
Chr 17: 70555686 - 70657386
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35095
Vector Insertion
Chr 17: 71012150 - 71067535
Public Clones IST12763D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16740
Vector Insertion
Chr 17: 71067566 - 71110414
Public Clones (ggtc) IST14006E12 (tigm) IST14717E9 (tigm) IST13339E4 (tigm) IST14748H6 (tigm)
IST14975C12 (tigm) IST12846G5 (tigm) IST13406F7 (tigm) IST13977B12 (tigm)
IST14816A6 (tigm) IST12263F1 (tigm) IST12418F12 (tigm) IST13994F7 (tigm)
IST14805A3 (tigm) IST13898F6 (tigm) IST10376C6 (tigm) IST10020A10 (tigm)
IST13498B3 (tigm) IST15084H1 (tigm) IST11628G11 (tigm) IST12891A12 (tigm)
IST12028F6 (tigm) IST11386B12 (tigm) IST10034H10 (tigm) IST15053H6 (tigm)
IST11086G1 (tigm) IST12576G8 (tigm) IST13205B10 (tigm) IST12889A8BBF1 (tigm)
IST10040C12 (tigm) IST10388D4 (tigm) IST10061F8 (tigm) IST10040A11 (tigm)
IST14372C7 (tigm) IST12268C3 (tigm) IST13789F3 (tigm) IST10471G12 (tigm)
IST14856C4 (tigm) IST11103H9 (tigm) IST11667C5 (tigm) IST11147E8 (tigm)
IST10239B2 (tigm)
Private Clones OST455272 (lexicon) OST285094 (lexicon) OST267862 (lexicon) OST243039 (lexicon)
OST237699 (lexicon) OST198546 (lexicon) OST194571 (lexicon) OST187410 (lexicon)
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23710
Vector Insertion
Chr 17: 71110786 - 71115337
Public Clones not available
Private Clones OST248226 (lexicon) OST171093 (lexicon) OST63887 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22725
Vector Insertion
Chr 17: 71115430 - 71136127
Public Clones E071G09 (ggtc) IST10032A11 (tigm) IST12393H12 (tigm) IST14257G9 (tigm)
IST13489H5 (tigm) IST13802E6 (tigm) IST14730D7 (tigm) IST14588F5 (tigm)
IST10973C10 (tigm) IST10890F5 (tigm) IST12937B5 (tigm) IST14738E6 (tigm)
Private Clones OST286449 (lexicon) OST203270 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13115
Vector Insertion
Chr 17: 71136550 - 71158527
Public Clones (sanger) D173H11 (ggtc) CMHD-GT_331B8-3 (cmhd) IST11996B9 (tigm)
IST13103F1 (tigm) IST10739A9 (tigm) IST15090E12 (tigm) IST12386A10 (tigm)
IST10748G6 (tigm)
Private Clones OST287877 (lexicon) OST99864 (lexicon) OST41918 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32100
Vector Insertion
Chr 17: 71158620 - 71164533
Public Clones IST10086B11 (tigm) IST10990F2 (tigm) IST12845A7 (tigm) IST13097E3 (tigm)
IST12206C12 (tigm) IST10989E3 (tigm) IST14249H2 (tigm) IST11006C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21962
Vector Insertion
Chr 17: 71164533 - 71164687
Public Clones CMHD-GT_510H12-3 (cmhd)
Private Clones OST312805 (lexicon) OST211328 (lexicon) OST167630 (lexicon) OST88710 (lexicon)
OST32585 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34209
Vector Insertion
Chr 17: 71165434 - 71167364
Public Clones IST10041G11 (tigm) IST11229C8 (tigm) IST14801H8 (tigm) IST14102G4 (tigm)
IST11803F6 (tigm) IST10866A7 (tigm) IST10221H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097288
Sequence
AGCTGCACACACCAAACCAAAGCTGACATGAATAATGAACTTAATTTTCCATAAGGACATTCTGTTGGGTGTTTCGGCTAATAAG GTTCCCCAGGATGA

ATGGTCAGGGTACACACCTCGCGGGAAAGACGACGAGATCCCGTGCCGGAGGATGCGCAGTGGTAGCTACATCAAAGCCATGGGGGATGAAGACAGTGGG

GACTCGGACACGAGCCCCAAGCCGTCTCCCAAGGTGGCTGCAAGAAGAGAAAGCTATCTCAAGGCCACGCAGCCGTCCCTTACAGAGCTCACCACTCTCA

A GATCTCCAATGAACACTCCCCCAAACTCCAGATCCGGAGTCACAGCTACCTGAGGGCCGTAAGTGAAGTCTCCATCAACAGAAGCCTGGACAGCCTGG

ACCCTGCAGGCTTGCTCACGTCACCAAAGTTCCGCTCCAGAAACGAGAGCTACATGCGCGCCATGAGCACCATAAGTCAG GTGAGCGAGATGGAGGTGA

ACGGCCAGTTCGAATCCGTGTGCGAGTCTGTGTTCAGCGAGCTGGAGTCGCAGGCGGTGGAAGCGCTGGACCTGCCCCTGCCTGGCTGCTTCCGCATGCG

GAGCCACAGCTATGTGCGGGCCATCGAAAAGGGCTGCTCCCAGGACGACGAATGCGTGTCGCTGCGGTCGTCCTCCCCTCCACGCACAACCACCACCGTG

AGGACCATCCAGAGCAGCACCG GTGTCATAAAACTGAGTTCTGCCGTTGAAG - UNI16740 - TGTCATCTTGCATTACAACATATAAGAAGACAC

CACCTCCAGTCCCACCCAGAACTACCACGAAACCTTTCATTTCTATCACAGCCCAGAGTAGCACAGAGTCTGCGCAGGATGCCTACATGGACGGGCAAGG

CCAGCGCGGAGACATGATCAGCCAGTCTGGCCTCAGCAACTCCACCGAAAGTCTGGACAGTATGAAGGCTCTCACGGCTGCCATCGAGGCTGCAAACGCC

CAGATTCACGGCCCAGCAAGTCAACATATGGGCAGCAATGCTGCTGCTGTCACCACCACCACCACCATAGCCACTGTCACCACCGAGGATAGGAAGAAAG

ACTTTAAGAAAAACCGATGTCTGTCTATTGGGATACAG - UNI23710 - GTGGACGATGCCGAAGAGCCGGAGAAAATGGCAGAGAGTAAGACGTCC

AATAAGTTCCAGTCCGTGGGAGTGCAAGTAGAAGAAGAGAAGTG - UNI22725 - CTTCCGCAGGTTCACTCGGTCCAACAGTGTGACAACTGCAGT

ACAGGCCGACCTGGACTTCCATGATAATCTGGAAAATTCTCTGGAGTCTATAGAGGACAATTCGTGTCCTGGCCCCATGGCCAGACAGTTCTCGCGGGAC

GCCAGCACCTCTACCGTCAGTATCCAGGGTTCAGGAAACCACTATCATGCCTGTGCAGCCGATGACGACTTTGACACGGATTTTGACCCCTCTATCCTGC

CTCCTCCGGACCCCTGGATTGACTCTATCACAGAAGACCCTCTGGAGGCCGTTCAAAGGTCCGTGTGCCACCGGGACGGCCACTGGTTCCTGAAGCTTCT

CCAGGCAGAGCGGGACCGCATGGAAGGGTGGTGCAAGCTAATGGAGAGAGAAGAGAGGGAGAACAACCTCCCAGAAGACA - UNI13115 - TTCTAG

GGAAAATCCGAACCGCGGTGGGCAGTGCCCAACTTCTCATGGCGCAGAAATTCTACCAGTTCAGAGAACTGTGTGAAGAGAACCTG - UNI21962 - 

- UNI32100 - AATCCCAATGCTCACCCGAGACCCACTTCCCAGGACTTGGCGGGGTTTTGGGACATGCTGCAGTTGTCCATAGAGAATATTAGTATG

AAATTTGATGAACTTCATCAGCTAAAGGCCAATAATTGGAAACAGATGGATCCTCTTGACAAGAAGGTAGAACAATGTAGATTTTGTATGGTCCATTTAA

AACCCTGCACAAACGCTGGACAGTCTAAATAGGCTGCTGCATTCAGTCCTGCTGTTCACAATGTGAAATGGAGCCGGTACTGTGTCATCTCATTGTAATG

ACAATGTTTACATACTAATCACTCGGGATAGTATCTGTAATGTGTCTCAGGCATATTTTTGAAGAAAAACCTGTCTTTGTGAATTGGGAAACGGGAATGT

GGCTTTTCTTTACCTTTTTCTTTCTCTTTCTTTCTTCCTTTACTTTTCTTTCATTTCTTTCTTTCTCTCTCTCTCTCTCTTTCTTTCTTTCTTTCTTTCT

TTCTTTCTTTTTTTCCTTTTCCAGTTAAATTAAACTTTAAGCTAAACCAGTTAGACACTGGGAGGGACTGCCTCCAGTTATGCTTTCTAAACTAAAATAA

ATGATTTCTTCAGTGCATGATTCCATAGAGCAAGAGTTGAACTTCCTCACATCCTCAGGATGGGTTTCTCAGAAACAGTAGGAAGCCCTAAGAAGTAACA

GACTGACAGTTACCTCAGAAATACATAACGAAGAAGTCACTGATGCTCGAGTCTCGGATGCTTTCATTGAGAGACTTACAGTCATCAGAAGCGCTGGGAT

TTTTTTTTTTTTCTAACTTATACTTTTGATTGACTGCCTGGGGGTGGGGGAAGACACTGTTCCCTGGGATCCTCATGCAACAGTTTAGAAATAAAGACTC

GAGTTCTTTTAAT
Translation
MNLIFHKDILLGVSANK VPQDEWSGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLK KISNEHSPK

LQIRSHSYLRAVSEVSINRSLDSLDPAGLLTSPKFRSRNESYMRAMSTISQ VSEMEVNGQFESVCESVFSELESQAVEALDLPLPGCFRMRSHSYVRAI

EKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTG GVIKLSSAVEV - UNI16740 - VSSCITTYKKTPPPVPPRTTTKPFISITAQSSTESAQDAYM

DGQGQRGDMISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGSNAAAVTTTTTIATVTTEDRKKDFKKNRCLSIGIQ - UNI23710 - VDD

AEEPEKMAESKTSNKFQSVGVQVEEEKC - UNI22725 - CFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQG

SGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCKLMEREERENNLPEDI - UNI13115 - IL

GKIRTAVGSAQLLMAQKFYQFRELCEENL - UNI21962 - - UNI32100 - NPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWKQ

MDPLDKKVEQCRFCMVHLKPCTNAGQSK
Transcript ENSMUST00000060072
Sequence
GGGTGGGAGCGCCTGGCTTCTGGCCGTGGCCGCCGCCCGCCCGCCGGCTCCCGTGGTTGGGCGGAGGAAGCGCGGGACTCCTCCTCCCCGCCGTATTAAC

ATGCACCCAGGGGCGGGTGACCAGCCCAGCCTCGCCGCCCCTGCCCGCCGCGTCCCGGCGCTCAGCCTCCGCTCCAGAGGCGAGCGCTGCGCTTCGGGCG

CCGCAAGCCCGAGGACGCGGCCTCGCAGCCACCTTCCGCCGGCGGGGAGCGGCAGGACCGGCGGCGCGAGCGGCTGCCGCCACCTCAGCGCCTGCTTGGG

CTCCTTCCCTTCACCTCGCTGAGAAACGTCCCGTACTGCGGGTTCACTGCTCTGGTCCTCGCTCCGAGGCTCGTGGGACGGACTGACAGACGGACGGAGC

AGCGACGGACAGACTGCGGGCAGCG AAAACTGTGGGTGATACTATCGGATCACTTCTAGTGACTGCTACTCAAACCTTTCCCTGGGACACTTTCTTCAA

AAGACCAGCACACATCCAACTTGCCCAGATATAATCCCAGATTAATGAAGGTCTTCTAGAAGGGACTACATTAGTCTCACCCGGACTG CGATTGCTGTT

GAGAATGCTAAATGGTTTGGCTACCATGGAAGTCAGAACAGAAGCTTCTCAGAAAAGAAAATTCGAATGACCATATGGCTCAGATGTACCACTCCTAG C

GCTCTTGAGCATCTCATACTAAGAGTGACATCTGGTTAATGCTATCAAGGACAGCAACAATCTGAAGTCGAGGTCTCCTCCTGCATCGGAAGCGTGGAAA

AATAAAAACAGAGAGCATCAAAG GTTACATCTGCTCTGGGACTTGCTGAATGTCACCTGAAGGCCCCTGTGTCTGCTTCAGAGAGCTCCTGTTGAATGA

CAAAGCCGCTAAGAGCA GTCTTTGCCCAAGAAGGGTCTGGAACTTAACGGGGTTCCCATGACCCTGGGATTGCTTCCAGTCAGCAATGAAAGGGTTATC

GGGTAGCCGCAGCCACCACCATGGGATCACCTGCGAGGCGGCCTGTGACTCCTTGTCACACCACTCAGACCACAAGCCGTACCTGCTGAGCCCCGTAGAC

CACCACCCTGCGGACCATCCCTACTACACCCAGCGGAATTCTTTCCAGGCCGAGTGCGTAGGGCCCTTCAGCGACCCGCTGGCCAGCAGCACCTTCCCGC

GCAGGCACTACACCTCGCAGCAGGAGCTGAAGGACGAGAGTGCCCTGGTACCACGCACCCTGGCCACCAAGGCGAATCGTCTCCCCACCAACCTGCTGGA

TCAGTTTGAGAGGCAGCTGCCCCTCAGCCGGGATGGCTATCACACGCTACAGTACAAGCGCACCGCTGTGGAGCATCGCAGCGATAGCCCCGGCCGCATC

CGGCACCTGGTCCACTCGGTCCAGAAGCTCTTTACTAAGTCTCATTCCCTGGAGGGGCCATCCAAAGGCAGCGTCAACGGGGGCAAGGCTAGCCCTGACG

AGTCGCAAACTCTGAGATATGGCAAGCGCAGCAAGAGCAAGGAGAGGCGATCAGAATCCAAGGCTAGATCCAATGCTTCTAACGCCTCCCCCACCTCTCC

CAGTTGGTGGAGTTCAGATGACAACCTGGATGGTGACATGTGCCTCTACCACACGCCCTCGGGTGTGATGACCATGGGCAGGTGTCCTGACCGCTCCGCT

TCGCAGTACTTCATGGAAGCCTACAACACCATCAGCGAGCAGGCAGTGAAGGCTTCCCGGAGTAACAATGACATCAAGTGCTCCACCTGTGCCAACCTGC

CAGTCACGCTGGATGCCCCGCTTCTGAAGAAGAGTGCCTGGTCCTCCACTCTCACCGTGAGCAGAGCCCGAGAGGTTTATCAGAAAGCCTCGGTGAACAT

GGATCAGGCCATGGTGAAGTCCGAAGCTTGTCAACAAGAGCGGTCCTGCCAGTACTTACAG GTTCCCCAGGATGAATGGTCAGGGTACACACCTCGCGG

GAAAGACGACGAGATCCCGTGCCGGAGGATGCGCAGTGGTAGCTACATCAAAGCCATGGGGGATGAAGACAGTGGGGACTCGGACACGAGCCCCAAGCCG

TCTCCCAAGGTGGCTGCAAGAAGAGAAAGCTATCTCAAGGCCACGCAGCCGTCCCTTACAGAGCTCACCACTCTCAA GATCTCCAATGAACACTCCCCC

AAACTCCAGATCCGGAGTCACAGCTACCTGAGGGCCGTAAGTGAAGTCTCCATCAACAGAAGCCTGGACAGCCTGGACCCTGCAGGCTTGCTCACGTCAC

CAAAGTTCCGCTCCAGAAACGAGAGCTACATGCGCGCCATGAGCACCATAAGTCAG GTGAGCGAGATGGAGGTGAACGGCCAGTTCGAATCCGTGTGCG

AGTCTGTGTTCAGCGAGCTGGAGTCGCAGGCGGTGGAAGCGCTGGACCTGCCCCTGCCTGGCTGCTTCCGCATGCGGAGCCACAGCTATGTGCGGGCCAT

CGAAAAGGGCTGCTCCCAGGACGACGAATGCGTGTCGCTGCGGTCGTCCTCCCCTCCACGCACAACCACCACCGTGAGGACCATCCAGAGCAGCACCG -

 UNI16740 - TGTCATCTTGCATTACAACATATAAGAAGACACCACCTCCAGTCCCACCCAGAACTACCACGAAACCTTTCATTTCTATCACAGCCCA

GAGTAGCACAGAGTCTGCGCAGGATGCCTACATGGACGGGCAAGGCCAGCGCGGAGACATGATCAGCCAGTCTGGCCTCAGCAACTCCACCGAAAGTCTG

GACAGTATGAAGGCTCTCACGGCTGCCATCGAGGCTGCAAACGCCCAGATTCACGGCCCAGCAAGTCAACATATGGGCAGCAATGCTGCTGCTGTCACCA

CCACCACCACCATAGCCACTGTCACCACCGAGGATAGGAAGAAAGACTTTAAGAAAAACCGATGTCTGTCTATTGGGATACAG - UNI23710 - GTG

GACGATGCCGAAGAGCCGGAGAAAATGGCAGAGAGTAAGACGTCCAATAAGTTCCAGTCCGTGGGAGTGCAAGTAGAAGAAGAGAAGTG - UNI22725

 - CTTCCGCAGGTTCACTCGGTCCAACAGTGTGACAACTGCAGTACAGGCCGACCTGGACTTCCATGATAATCTGGAAAATTCTCTGGAGTCTATAGAG

GACAATTCGTGTCCTGGCCCCATGGCCAGACAGTTCTCGCGGGACGCCAGCACCTCTACCGTCAGTATCCAGGGTTCAGGAAACCACTATCATGCCTGTG

CAGCCGATGACGACTTTGACACGGATTTTGACCCCTCTATCCTGCCTCCTCCGGACCCCTGGATTGACTCTATCACAGAAGACCCTCTGGAGGCCGTTCA

AAGGTCCGTGTGCCACCGGGACGGCCACTGGTTCCTGAAGCTTCTCCAGGCAGAGCGGGACCGCATGGAAGGGTGGTGCAAGCTAATGGAGAGAGAAGAG

AGGGAGAACAACCTCCCAGAAGACA - UNI13115 - TTCTAGGGAAAATCCGAACCGCGGTGGGCAGTGCCCAACTTCTCATGGCGCAGAAATTCTA

CCAGTTCAGAGAACTGTGTGAAGAGAACCTG - UNI21962 - - UNI32100 - AATCCCAATGCTCACCCGAGACCCACTTCCCAGGACTTGGCG

GGGTTTTGGGACATGCTGCAGTTGTCCATAGAGAATATTAGTATGAAATTTGATGAACTTCATCAGCTAAAGGCCAATAATTGGAAACAGATGGATCCTC

TTGACAAGAAG - UNI21962 - GAGCGAAGGGCCCCTCCTCCAGTGCCAAAGAAGCCGGCGAAGGGCCCCGCGCCGCTGATCCGGGAGCGCTCGCTG

GAGAGCTCGCAGCGCCAGGAGGCCCGCAAGCGCCTGATGGCCGCCAAGCGCGCCGCGTCGGTCCGCCAGAACTCGGCCACCGAGAGCGCCGAGAGCATCG

AGATCTACATCCCCGAGGCGCAGACCCGGCTCTGAACGCCGCCGAGGACCGTCCCGCATCCCTGCCCTCGGCCACCTCCCCGCCCCCTCCGTCTCTGAGC

TCAGTGACAGCCACCGCCGTGGCGTAGTTGTCCACCTCGCAGGAGCCGTCCCCAGGCCGCCCCGCTTCCTGGACCACTTTGCCCATCTTCTCCACCGAGC

TTCGCTCCCCCCGTCCTGAAGCCTCATGCAGACATCCAAACCCTTTATTTTCTGGGCCAAGCAAACCCACCTATGTAGAAAACGACACCTGTAGGTCACT

CACATCCTCCTCAGTTCTCTCAAGCTAGTGTGTCCCTAGAATTCAGCAATATAAAACCATAGGGTATTTCAGAAACCCAGTATCACATAGGGTGATCCTT

TGGGACTTACCGTCTTCCATGTGAAAGAAACGAGGGCTCCAACTCCCTTTATTTGCCCCCAAACAGTTACTTTTTACAAACAGAGAGCGCTTTATTTCTA

ATCTCAGAAATCACACCATCTCATTGGAATCAAGGTGACAGAGTGGGGACCAAGTTGGCCTAGGGTTGGGGGGCCTGGGTGTGTAAGAGAGAAGGGCGGA

GTGCGCAGGTACCTGCATCTGTGCCCTCCCTCGCAGCTGTACAAACTGCCTCACTGGTACTTCATCAACCAAGCTTCAAATGTTTCAATCAGCAGAAGAT

TGTAAATTCGATCTTTCAGGGAAATCAATCTATTCTGAAAGGCAATAAAAGGAAGAAAGTTAAGGCAAAAGGGAAATAAATACCGGTGGGTTAAGATCCT

CTGTAAGGAATCCATTTATTTACCTTAAGAAAATTTAGAACTGAAATGTGTTTTTTTTTTAAATCAACTTTTCTTGTACTCTATGTATTATAATGTCATG

GCAATGGTTTTTAAATGGGAGGGTGGGAAAGAGTTGGTTCTGTCAGTTTAGTGTCCATCCTGGTGGGGCCACTTAAGGTTTCACACACGGAAGAACGTTT

CTGCTTCTGAGGGGCGGCAAGGACAATGCCAGAGGAGAGTTCGGGTTCTCCGCCACCCTTTGAATGCCACACCTGTCTAGTTCACATTTCCCGGGGGCGT

TTTCTCCTTTGGTTTCCTTTCACTCCAATACAGAGTTCACCTGTTCCCCAGCACAGGATTTTGTTCTATGTCAAATGAATAAAATAAAAGGTTTTCTACC

CCAGTTGACACGCTGCCTCATTCCCAAGAGCTGTCGTTGTGATCCTGAAGTTCCAGGTAGTGAGAGAAGTCATTTGAGACGCAGGGGTCAAGAACAAGGA

GGCGGCAGGGCAGGCGGCATTCATAAACGCTGATAGAAAGCCAAATCTTTGGGTGGATTCCAGGCTGGTTGTTGGCTTGCAATTTAGTCGTCATTGATGG

GCTGTGTGTCCTAGCTTCCAGCTGAAGTCTTCAAATGCCCTTTACTTGCAGCAGTTTAAACATTCAGAATGTGGCTATCTGAAAAGATCAGCTGGCAACC

TAAAGAATTAGAAATTTGTCATAGG
Translation
     MKGLSGSRSHHHGITCEAACDSLSHHSDHKPYLLSPVDHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDESALVPRTLATK

ANRLPTNLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDESQTLRYGKRSKSKERRSESKARS

NASNASPTSPSWWSSDDNLDGDMCLYHTPSGVMTMGRCPDRSASQYFMEAYNTISEQAVKASRSNNDIKCSTCANLPVTLDAPLLKKSAWSSTLTVSRAR

EVYQKASVNMDQAMVKSEACQQERSCQYLQ VPQDEWSGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELT

TLK KISNEHSPKLQIRSHSYLRAVSEVSINRSLDSLDPAGLLTSPKFRSRNESYMRAMSTISQ VSEMEVNGQFESVCESVFSELESQAVEALDLPLPG

CFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTV - UNI16740 - VSSCITTYKKTPPPVPPRTTTKPFISITAQSSTESAQDAY

MDGQGQRGDMISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGSNAAAVTTTTTIATVTTEDRKKDFKKNRCLSIGIQ - UNI23710 - VD

DAEEPEKMAESKTSNKFQSVGVQVEEEKC - UNI22725 - CFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDNSCPGPMARQFSRDASTSTVSIQ

GSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCKLMEREERENNLPEDI - UNI13115 - I

LGKIRTAVGSAQLLMAQKFYQFRELCEENL - UNI21962 - - UNI32100 - NPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWK

QMDPLDKK - UNI21962 - ERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQTRL
Transcript ENSMUST00000003366
Sequence
GGGTGGGAGCGCCTGGCTTCTGGCCGTGGCCGCCGCCCGCCCGCCGGCTCCCGTGGTTGGGCGGAGGAAGCGCGGGACTCCTCCTCCCCGCCGTATTAAC

ATGCACCCAGGGGCGGGTGACCAGCCCAGCCTCGCCGCCCCTGCCCGCCGCGTCCCGGCGCTCAGCCTCCGCTCCAGAGGCGAGCGCTGCGCTTCGGGCG

CCGCAAGCCCGAGGACGCGGCCTCGCAGCCACCTTCCGCCGGCGGGGAGCGGCAGGACCGGCGGCGCGAGCGGCTGCCGCCACCTCAGCGCCTGCTTGGG

CTCCTTCCCTTCACCTCGCTGAGAAACGTCCCGTACTGCGGGTTCACTGCTCTGGTCCTCGCTCCGAGGCTCGTGGGACGGACTGACAGACGGACGGAGC

AGCGACGGACAGACTGCGGGCAGCG AAAACTGTGGGTGATACTATCGGATCACTTCTAGTGACTGCTACTCAAACCTTTCCCTGGGACACTTTCTTCAA

AAGACCAGCACACATCCAACTTGCCCAGATATAATCCCAGATTAATGAAGGTCTTCTAGAAGGGACTACATTAGTCTCACCCGGACTG CGATTGCTGTT

GAGAATGCTAAATGGTTTGGCTACCATGGAAGTCAGAACAGAAGCTTCTCAGAAAAGAAAATTCGAATGACCATATGGCTCAGATGTACCACTCCTAG C

GCTCTTGAGCATCTCATACTAAGAGTGACATCTGGTTAATGCTATCAAGGACAGCAACAATCTGAAGTCGAGGTCTCCTCCTGCATCGGAAGCGTGGAAA

AATAAAAACAGAGAGCATCAAAG GTTACATCTGCTCTGGGACTTGCTGAATGTCACCTGAAGGCCCCTGTGTCTGCTTCAGAGAGCTCCTGTTGAATGA

CAAAGCCGCTAAGAGCA GTCTTTGCCCAAGAAGGGTCTGGAACTTAACGGGGTTCCCATGACCCTGGGATTGCTTCCAGTCAGCAATGAAAGGGTTATC

GGGTAGCCGCAGCCACCACCATGGGATCACCTGCGAGGCGGCCTGTGACTCCTTGTCACACCACTCAGACCACAAGCCGTACCTGCTGAGCCCCGTAGAC

CACCACCCTGCGGACCATCCCTACTACACCCAGCGGAATTCTTTCCAGGCCGAGTGCGTAGGGCCCTTCAGCGACCCGCTGGCCAGCAGCACCTTCCCGC

GCAGGCACTACACCTCGCAGCAGGAGCTGAAGGACGAGAGTGCCCTGGTACCACGCACCCTGGCCACCAAGGCGAATCGTCTCCCCACCAACCTGCTGGA

TCAGTTTGAGAGGCAGCTGCCCCTCAGCCGGGATGGCTATCACACGCTACAGTACAAGCGCACCGCTGTGGAGCATCGCAGCGATAGCCCCGGCCGCATC

CGGCACCTGGTCCACTCGGTCCAGAAGCTCTTTACTAAGTCTCATTCCCTGGAGGGGCCATCCAAAGGCAGCGTCAACGGGGGCAAGGCTAGCCCTGACG

AGTCGCAAACTCTGAGATATGGCAAGCGCAGCAAGAGCAAGGAGAGGCGATCAGAATCCAAGGCTAGATCCAATGCTTCTAACGCCTCCCCCACCTCTCC

CAGTTGGTGGAGTTCAGATGACAACCTGGATGGTGACATGTGCCTCTACCACACGCCCTCGGGTGTGATGACCATGGGCAGGTGTCCTGACCGCTCCGCT

TCGCAGTACTTCATGGAAGCCTACAACACCATCAGCGAGCAGGCAGTGAAGGCTTCCCGGAGTAACAATGACATCAAGTGCTCCACCTGTGCCAACCTGC

CAGTCACGCTGGATGCCCCGCTTCTGAAGAAGAGTGCCTGGTCCTCCACTCTCACCGTGAGCAGAGCCCGAGAGGTTTATCAGAAAGCCTCGGTGAACAT

GGATCAGGCCATGGTGAAGTCCGAAGCTTGTCAACAAGAGCGGTCCTGCCAGTACTTACAG GTTCCCCAGGATGAATGGTCAGGGTACACACCTCGCGG

GAAAGACGACGAGATCCCGTGCCGGAGGATGCGCAGTGGTAGCTACATCAAAGCCATGGGGGATGAAGACAGTGGGGACTCGGACACGAGCCCCAAGCCG

TCTCCCAAGGTGGCTGCAAGAAGAGAAAGCTATCTCAAGGCCACGCAGCCGTCCCTTACAGAGCTCACCACTCTCAA GATCTCCAATGAACACTCCCCC

AAACTCCAGATCCGGAGTCACAGCTACCTGAGGGCCGTAAGTGAAGTCTCCATCAACAGAAGCCTGGACAGCCTGGACCCTGCAGGCTTGCTCACGTCAC

CAAAGTTCCGCTCCAGAAACGAGAGCTACATGCGCGCCATGAGCACCATAAGTCAG GTGAGCGAGATGGAGGTGAACGGCCAGTTCGAATCCGTGTGCG

AGTCTGTGTTCAGCGAGCTGGAGTCGCAGGCGGTGGAAGCGCTGGACCTGCCCCTGCCTGGCTGCTTCCGCATGCGGAGCCACAGCTATGTGCGGGCCAT

CGAAAAGGGCTGCTCCCAGGACGACGAATGCGTGTCGCTGCGGTCGTCCTCCCCTCCACGCACAACCACCACCGTGAGGACCATCCAGAGCAGCACCG G

TGTCATAAAACTGAGTTCTGCCGTTGAAG - UNI16740 - TGTCATCTTGCATTACAACATATAAGAAGACACCACCTCCAGTCCCACCCAGAACTA

CCACGAAACCTTTCATTTCTATCACAGCCCAGAGTAGCACAGAGTCTGCGCAGGATGCCTACATGGACGGGCAAGGCCAGCGCGGAGACATGATCAGCCA

GTCTGGCCTCAGCAACTCCACCGAAAGTCTGGACAGTATGAAGGCTCTCACGGCTGCCATCGAGGCTGCAAACGCCCAGATTCACGGCCCAGCAAGTCAA

CATATGGGCAGCAATGCTGCTGCTGTCACCACCACCACCACCATAGCCACTGTCACCACCGAGGATAGGAAGAAAGACTTTAAGAAAAACCGATGTCTGT

CTATTGGGATACAG - UNI23710 - GTGGACGATGCCGAAGAGCCGGAGAAAATGGCAGAGAGTAAGACGTCCAATAAGTTCCAGTCCGTGGGAGTG

CAAGTAGAAGAAGAGAAGTG - UNI22725 - CTTCCGCAGGTTCACTCGGTCCAACAGTGTGACAACTGCAGTACAGGCCGACCTGGACTTCCATGA

TAATCTGGAAAATTCTCTGGAGTCTATAGAGGACAATTCGTGTCCTGGCCCCATGGCCAGACAGTTCTCGCGGGACGCCAGCACCTCTACCGTCAGTATC

CAGGGTTCAGGAAACCACTATCATGCCTGTGCAGCCGATGACGACTTTGACACGGATTTTGACCCCTCTATCCTGCCTCCTCCGGACCCCTGGATTGACT

CTATCACAGAAGACCCTCTGGAGGCCGTTCAAAGGTCCGTGTGCCACCGGGACGGCCACTGGTTCCTGAAGCTTCTCCAGGCAGAGCGGGACCGCATGGA

AGGGTGGTGCAAGCTAATGGAGAGAGAAGAGAGGGAGAACAACCTCCCAGAAGACA - UNI13115 - TTCTAGGGAAAATCCGAACCGCGGTGGGCA

GTGCCCAACTTCTCATGGCGCAGAAATTCTACCAGTTCAGAGAACTGTGTGAAGAGAACCTG - UNI21962 - - UNI32100 - AATCCCAATGC

TCACCCGAGACCCACTTCCCAGGACTTGGCGGGGTTTTGGGACATGCTGCAGTTGTCCATAGAGAATATTAGTATGAAATTTGATGAACTTCATCAGCTA

AAGGCCAATAATTGGAAACAGATGGATCCTCTTGACAAGAAG - UNI21962 - GAGCGAAGGGCCCCTCCTCCAGTGCCAAAGAAGCCGGCGAAGGG

CCCCGCGCCGCTGATCCGGGAGCGCTCGCTGGAGAGCTCGCAGCGCCAGGAGGCCCGCAAGCGCCTGATGGCCGCCAAGCGCGCCGCGTCGGTCCGCCAG

AACTCGGCCACCGAGAGCGCCGAGAGCATCGAGATCTACATCCCCGAGGCGCAGACCCGGCTCTGAACGCCGCCGAGGACCGTCCCGCATCCCTGCCCTC

GGCCACCTCCCCGCCCCCTCCGTCTCTGAGCTCAGTGACAGCCACCGCCGTGGCGTAGTTGTCCACCTCGCAGGAGCCGTCCCCAGGCCGCCCCGCTTCC

TGGACCACTTTGCCCATCTTCTCCACCGAGCTTCGCTCCCCCCGTCCTGAAGCCTCATGCAGACATCCAAACCCTTTATTTTCTGGGCCAAGCAAACCCA

CCTATGTAGAAAACGACACCTGTAGGTCACTCACATCCTCCTCAGTTCTCTCAAGCTAGTGTGTCCCTAGAATTCAGCAATATAAAACCATAGGGTATTT

CAGAAACCCAGTATCACATAGGGTGATCCTTTGGGACTTACCGTCTTCCATGTGAAAGAAACGAGGGCTCCAACTCCCTTTATTTGCCCCCAAACAGTTA

CTTTTTACAAACAGAGAGCGCTTTATTTCTAATCTCAGAAATCACACCATCTCATTGGAATCAAGGTGACAGAGTGGGGACCAAGTTGGCCTAGGGTTGG

GGGGCCTGGGTGTGTAAGAGAGAAGGGCGGAGTGCGCAGGTACCTGCATCTGTGCCCTCCCTCGCAGCTGTACAAACTGCCTCACTGGTACTTCATCAAC

CAAGCTTCAAATGTTTCAATCAGCAGAAGATTGTAAATTCGATCTTTCAGGGAAATCAATCTATTCTGAAAGGCAATAAAAGGAAGAAAGTTAAGGCAAA

AGGGAAATAAATACCGGTGGGTTAAGATCCTCTGTAAGGAATCCATTTATTTACCTTAAGAAAATTTAGAACTGAAATGTGTTTTTTTTTTAAATCAACT

TTTCTTGTACTCTATGTATTATAATGTCATGGCAATGGTTTTTAAATGGGAGGGTGGGAAAGAGTTGGTTCTGTCAGTTTAGTGTCCATCCTGGTGGGGC

CACTTAAGGTTTCACACACGGAAGAACGTTTCTGCTTCTGAGGGGCGGCAAGGACAATGCCAGAGGAGAGTTCGGGTTCTCCGCCACCCTTTGAATGCCA

CACCTGTCTAGTTCACATTTCCCGGGGGCGTTTTCTCCTTTGGTTTCCTTTCACTCCAATACAGAGTTCACCTGTTCCCCAGCACAGGATTTTGTTCTAT

GTCAAATGAATAAAATAAAAGGTTTTCTACCCCAGTTGACACGCTGCCTCATTCCCAAGAGCTGTCGTTGTGATCCTGAAGTTCCAGGTAGTGAGAGAAG

TCATTTGAGACGCAGGGGTCAAGAACAAGGAGGCGGCAGGGCAGGCGGCATTCATAAACGCTGATAGAAAGCCAAATCTTTGGGTGGATTCCAGGCTGGT

TGTTGGCTTGCAATTTAGTCGTCATTGATGGGCTGTGTGTCCTAGCTTCCAGCTGAAGTCTTCAAATGCCCTTTACTTGCAGCAGTTTAAACATTCAGAA

TGTGGCTATCTGAAAAGATCAGCTGGCAACCTAAAGAATTAGAAATTTGTCATAGG
Translation
     MKGLSGSRSHHHGITCEAACDSLSHHSDHKPYLLSPVDHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDESALVPRTLATK

ANRLPTNLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDESQTLRYGKRSKSKERRSESKARS

NASNASPTSPSWWSSDDNLDGDMCLYHTPSGVMTMGRCPDRSASQYFMEAYNTISEQAVKASRSNNDIKCSTCANLPVTLDAPLLKKSAWSSTLTVSRAR

EVYQKASVNMDQAMVKSEACQQERSCQYLQ VPQDEWSGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELT

TLK KISNEHSPKLQIRSHSYLRAVSEVSINRSLDSLDPAGLLTSPKFRSRNESYMRAMSTISQ VSEMEVNGQFESVCESVFSELESQAVEALDLPLPG

CFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTG GVIKLSSAVEV - UNI16740 - VSSCITTYKKTPPPVPPRTTTKPFISIT

AQSSTESAQDAYMDGQGQRGDMISQSGLSNSTESLDSMKALTAAIEAANAQIHGPASQHMGSNAAAVTTTTTIATVTTEDRKKDFKKNRCLSIGIQ - U

NI23710 - VDDAEEPEKMAESKTSNKFQSVGVQVEEEKC - UNI22725 - CFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDNSCPGPMARQF

SRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDPLEAVQRSVCHRDGHWFLKLLQAERDRMEGWCKLMEREERENNLPEDI - 

UNI13115 - ILGKIRTAVGSAQLLMAQKFYQFRELCEENL - UNI21962 - - UNI32100 - NPNAHPRPTSQDLAGFWDMLQLSIENISMKF

DELHQLKANNWKQMDPLDKK - UNI21962 - ERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSATESAESIEIYIPEAQ

TRL

For any suggestions or comments, please send an email to unitrap@crg.es