Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003308 (Keap1)
Chromosomal location
Chr 9: 21034511 - 21043261 (-)
Description
kelch-like ECH-associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:1858732]
RefSeq_peptide
NP_057888.1 NP_001103775.1 NP_001103776.1 NP_001103777.1 
UniGene
Mm.248266 
MGI
MGI:1858732 
Uniprot/SWISSPROT
Q9Z2X8 
Uniprot/SPTREMBL
O89076 Q05DM3 Q3UWI4 
Human Ortholog
ENSG00000079999 (KEAP1)
Omim not available
UniTrap UNI28319
Vector Insertion
Chr 9: 21042201 - 21043236
Public Clones IST13213E6 (tigm) IST14959D3 (tigm)
Private Clones OST34042 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24790
Vector Insertion
Chr 9: 21036347 - 21037831
Public Clones not available
Private Clones OST206735 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17212
Vector Insertion
Chr 9: 21035871 - 21036140
Public Clones not available
Private Clones OST447520 (lexicon) OST447379 (lexicon) OST425292 (lexicon) OST425291 (lexicon)
OST184789 (lexicon) OST72891 (lexicon) OST34122 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17543
Vector Insertion
Chr 9: 21035313 - 21035693
Public Clones not available
Private Clones OST440877 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049567
Sequence
GGAGGCAGAGCGCGGCCATGGCGGG - UNI28319 - GCCCCTAACGGCTAGCAGAGGAACTGTGTCTTGTCATCAGGAACCCCATGCAGCCCGAACC

CAAGCTTAGCGGGGCTCCCCGCAGCAGCCAGTTCCTGCCCCTGTGGTCAAAGTGCCCCGAGGGGGCCGGGGACGCAGTGATGTATGCCTCCACGGAGTGC

AAGGCAGAGGTGACGCCCTCGCAGGACGGTAACCGAACCTTCAGCTACACACTAGAGGATCACACCAAGCAGGCTTTTGGCGTCATGAACGAGCTTCGCC

TGAGCCAGCAACTCTGTGACGTGACCCTGCAGGTCAAATATGAGGACATCCCAGCTGCCCAATTCATGGCTCACAAAGTGGTGCTGGCCTCCTCCAGCCC

AGTCTTTAAAGCCATGTTCACCAACGGGCTTCGGGAGCAGGGCATGGAGGTGGTGTCCATCGAAGGCATCCACCCTAAGGTCATGGAAAGGCTTATTGAG

TTCGCCTACACGGCCTCCATCTCCGTGGGCGAGAAGTGTGTCCTGCACGTGATGAACGGGGCGGTCATGTACCAGATTGACAGCGTGGTTCGAGCCTGCA

GCGACTTCCTCGTGCAGCAGCTGGACCCCAGCAACGCCATTGGCATCGCCAACTTCGCGGAGCAGATCGGCTGCACTGAACTGCACCAGCGTGCCCGGGA

GTATATCTACATGCACTTCGGGGAG GTGGCCAAGCAGGAGGAGTTCTTCAACCTGTCACACTGCCAGCTGGCCACGCTCATCAGCCGGGATGATCTGAA

CGTACGCTGCGAGTCCGAGGTGTTCCACGCGTGCATCGACTGGGTCAAATACGACTGCCCGCAGCGGCGCTTCTACGTGCAGGCACTGCTGCGGGCCGTG

CGCTGCCATGCGCTCACGCCGCGCTTCCTGCAGACGCAGCTGCAGAAGTGTGAGATCCTGCAGGCCGACGCGCGCTGCAAGGACTACCTGGTGCAGATAT

TCCAGGAGCTCACGCTGCACAAGCCCACGCAGGCAGTGCCCTGCCGCGCGCCCAAAGTGGGCCGCCTCATCTACACAGCGGGCGGTTACTTCCGACAGTC

GCTCAGCTACCTGGAGGCCTACAACCCGAGCAATGGCTCCTGGCTGCGCCTGGCCGATCTACAGGTGCCGCGCAGTGGGCTGGCAGGCTGCGTGGTGGGT

GGGCTGCTATACGCTGTGGGCGGCCGCAACAACTCTCCGGATGGCAACACTGACTCCAGCGCCCTGGACTGCTACAACCCCATGACCAACCAGTGGTCGC

CCTGTGCCTCTATGAGCGTGCCACGCAACCGCATCGGGGTGGGGGTCATAGATGGCCACATCTACGCAGTCGGGGGTTCCCACGGCTGCATCCACCACAG

CAGCGTGGAGAG - UNI24790 - ATATGAGCCAGAGCGGGACGAGTGGCATCTAGTCGCGCCAATGTTGACACGGAGGATTGGCGTGGGCGTGGCAG

TGCTCAACCGCTTGCTGTATGCAGTGGGGGGCTTTGACGGGACTAACCGGCTTAACTCCGCAGAATGTTACTATCCAGAGAGGAATGAGTGGCGGATGAT

CACACCGATGAATACCATCCGGAGCGGGGCCG - UNI17212 - GGGTCTGCGTGCTGCACAACTGTATCTATGCAGCAGGGGGCTACGATGGGCAGG

ACCAGTTGAACAGTGTGGAGCGCTACGACGTGGAGACAGAGACCTGGACTTTCGTAGCCCCCATGAGGCATCACCGTAGTGCGCTGGGGATTACTGTGCA

CCAGGGCAAGATCTACGTCCTCG - UNI17543 - GAGGCTATGATGGCCACACTTTTCTGGACAGTGTGGAATGCTATGACCCGGACAGTGATACCT

GGAGTGAGGTGACCCGCATGACATCTGGCCGCAGCGGGGTGGGTGTGGCCGTCACCATGGAACCCTGTCGGAAGCAAATTGATCAACAAAACTGTACCTG

CTGAAGCACTTGGAATACCTGAGCACTGACAACAGGACAGAAAAACAGTCTGTGTATCACTGCTTCTCTGTACTAAAGAAAAAAGAAGAAAACAAAGCAT

AAACAGAAAACACAGGGCCGAAGAGGCGGCAGAAGAAGTCATCCCTTCTTCCAGGAAGGGCGACTGGGATGCCTTGTAAAGGACCTTGTGGAAGACCAGA

ACTCAAATCCATGGGCCCATCTGTCATAGCCCTGGAGCGTCCAAGTCTGGGATGGGGTATGGGCGGGGCACCCTCACAGGTGAGAAGCCCTTGAACTCCC

ACCACCAGAAGGGGGGGGACAGGCAAAGCAGGAGATCACATGTTTTTTTCTTTGGTTCCTGCAACTCGGTGATCAATTCCAGTGGACAGGGGAAGAAGGG

ACAGCTGAGGCCAAGGGGCTGAGGCTCCCTCTGGAACTGGGGCCCAAGGGACAAGCCGGCACAGAGAAGCCTCTGGGCTCTGAGCCCTGAACAGTTATTT

TGTTAAATAACCCTGTAAGTTTCCCATGGGAATAAAGAATGGAGTAGGCACACAGGTCTTCAGAGGGCGGTCGGAATCCCTCAGGGAGAGACAGCTCTTC

TATTGAAATACACGCAGATCCTGATGGGGCTGGTATCTG
Translation
 - UNI28319 - MQPEPKLSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHTKQAFGVMNELRLSQQLCDVTLQVKYE

DIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIG

IANFAEQIGCTELHQRAREYIYMHFGE VAKQEEFFNLSHCQLATLISRDDLNVRCESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQL

QKCEILQADARCKDYLVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPD

GNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVER - UNI24790 - RYEPERDEWHLVAPMLTRRIGVGVAVLNR

LLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAG - UNI17212 - GVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRS

ALGITVHQGKIYVLG - UNI17543 - GGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

For any suggestions or comments, please send an email to unitrap@crg.es