Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003309 (Ap1m2)
Chromosomal location
Chr 9: 21099905 - 21116755 (-)
Description
adaptor protein complex AP-1, mu 2 subunit Gene [Source:MGI Symbol;Acc:MGI:1336974]
RefSeq_dna
NM_009678 
RefSeq_peptide
NP_033808.2 NP_001103770.1 
MGI
MGI:1336974 
Uniprot/SWISSPROT
Q9WVP1 
Uniprot/SPTREMBL
Q8C9K8 
Human Ortholog
ENSG00000129354 (AP1M2)
Omim not available
UniTrap UNI34923
Vector Insertion
Chr 9: 21103722 - 21106972
Public Clones IST14888D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003397
Sequence
GGAAGCCGCAGCGCTGCCGCCTCTGCAGCTCGCTCTCGCCTCCTAGCTTCACGGACTGCCACCATGTCGGCCTCGGCAGTCTTCATTCTGGACGTCAAGG

GCAAG CCTCTGATTAGCCGAAACTACAAAGGTGATGTGCCCATGACAGAGATTGACCACTTCATGCCGCTGCTTATGCAGCGTGAGGAGGAGGGCGTGC

TGGCCCCGCTGCTGAGCCACGGCCGAGTGCACTTCCTGTGGATCAAACACAGCAACCTCTACT TGGTGGCCACCACGCTGAAGAACGCTAATGCCTCTC

TGGTGTACTCCTTTCTGTACAAGACTGTGGAG GTCTTCTGCGAGTACTTTAAGGAGCTGGAGGAGGAGAGCATCCGGGACAACTTCGTCATCGTGTACG

AGCTGCTGGATGAGCTCATGGACTTCGGCTTTCCGCAGACCACAGACAGCAAGATCCTGCAGGAGTACATCACACAACAGGGCAACAAGCTGGAGACTGG

CAAATCTCGTGTACCACCTACAGTCACCAATGCGGTGTCGTGGCGCTCTGAGGGCATTAAGTACAAAAAGAATGAGGTCTTCATTGATGTCATTGAGTCT

GTCAACCTTCTG GTCAATGCTAATGGGAGTGTCTTGCTCAGCGAGATTGTGGGCACCATCAAGCTGAAGGTGTTTCTGTCTGGGATGCCAGAGCTGCGG

CTGGGCCTCAATGACCGAGTGCTCTTTGAGCTTACTGGCC GCAGCAAGAACAAGTCTGTGGAACTGGAAGATGTGAAATTCCACCAATGTGTGAGGCTT

TCACGCTTTGACAACGACCGAACCATCTCCTTCATACCCCCAGATGGGGACTTTGAACTCATGTCCTACCGGCTTAGCACCCAG - UNI34923 - GT

CAAACCCCTGATCTGGATCGAGTCAGTCATTGAGAAATTCTCGCACAGCCGAGTGGAGATCATGGTGAAG - UNI34923 - GCCAAGGGTCAGTTTA

AGAAGCAGTCGGTGGCCAATGGCGTGGAAATCTCTGTGCCCGTTCCTAGTGATGCAGACTCTCCGCGCTTCAAGACCAGTGTGGGCAGTGCCAAGTATGT

GCCTGAGAAGAATGTTGTCATCTGGAGCATCAAGTCATTCCCT - UNI34923 - GGGGGAAAGGAGTACTTGATGCGTGCCCACTTTGGCCTCCCCA

GCGTGGAAACTGAGGAGGTAGAGGGCCGACCACCCATCGGGGTCAAGTTTGAGATTCCATACTTTACCGTTTCTGGCATCCAG GTCCGTTACATGAAGA

TCATCGAGAAAAGTGGGTACCAGGCCCTGCCCTGGGTCCGTTACATCACGCAGAGTGGTG ATTATCAACTTCGTACCAGCTAGAAGGGAGAAGAAGTGG

GGCTTCCATCTCCCCAGATACCAGCTGCAGACTTTTAAGAGCTGTGTGTGTGTGTTTGTGAGTGTGCACACGCGAGTGTGTGCAGGGTTAGGGCACTGAC

TTAACACATCCTTGCTGCCCACACCTAACCCCCTTTACCTCTCTCAGCCATCTGGGGTGGTTTCTTTGTGTCCCACCCTAATTTTATATGAAGAAATATA

AGAGGGCCTGAACTCTGCTGCCCGGCCCGCCCCCCATGAGTGCCTTCTTGCAGTAAACTGCCTTGGGCAGATCTAGGGCCCACCTTTTATAGCTGCTGAG

CCGAGGCCACTGGTCCTCCATCTGGGTTTTAGGGTGTCATTAAAATGAATCTAAC
Translation
MSASAVFILDVKGK PLISRNYKGDVPMTEIDHFMPLLMQREEEGVLAPLLSHGRVHFLWIKHSNLYL LVATTLKNANASLVYSFLYKTVE VFCEYFK

ELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQGNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLL VNANGSVLLSEIV

GTIKLKVFLSGMPELRLGLNDRVLFELTGR RSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQ - UNI34923 - VKPLIWI

ESVIEKFSHSRVEIMVK - UNI34923 - AKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNVVIWSIKSFP - UNI34923 - GG

KEYLMRAHFGLPSVETEEVEGRPPIGVKFEIPYFTVSGIQ VRYMKIIEKSGYQALPWVRYITQSGD DYQLRTS
Transcript ENSMUST00000115433
Sequence
GGAAGCCGCAGCGCTGCCGCCTCTGCAGCTCGCTCTCGCCTCCTAGCTTCACGGACTGCCACCATGTCGGCCTCGGCAGTCTTCATTCTGGACGTCAAGG

GCAAG CCTCTGATTAGCCGAAACTACAAAGGTGATGTGCCCATGACAGAGATTGACCACTTCATGCCGCTGCTTATGCAGCGTGAGGAGGAGGGCGTGC

TGGCCCCGCTGCTGAGCCACGGCCGAGTGCACTTCCTGTGGATCAAACACAGCAACCTCTACT TGGTGGCCACCACGCTGAAGAACGCTAATGCCTCTC

TGGTGTACTCCTTTCTGTACAAGACTGTGGAG GTCTTCTGCGAGTACTTTAAGGAGCTGGAGGAGGAGAGCATCCGGGACAACTTCGTCATCGTGTACG

AGCTGCTGGATGAGCTCATGGACTTCGGCTTTCCGCAGACCACAGACAGCAAGATCCTGCAGGAGTACATCACACAACAGGGCAACAAGCTGGAGACTGG

CAAATCTCGTGTACCACCTACAGTCACCAATGCGGTGTCGTGGCGCTCTGAGGGCATTAAGTACAAAAAGAATGAGGTCTTCATTGATGTCATTGAGTCT

GTCAACCTTCTG GTCAATGCTAATGGGAGTGTCTTGCTCAGCGAGATTGTGGGCACCATCAAGCTGAAGGTGTTTCTGTCTGGGATGCCAGAGCTGCGG

CTGGGCCTCAATGACCGAGTGCTCTTTGAGCTTACTGGCC TTTCAGGCAGCAAGAACAAGTCTGTGGAACTGGAAGATGTGAAATTCCACCAATGTGTG

AGGCTTTCACGCTTTGACAACGACCGAACCATCTCCTTCATACCCCCAGATGGGGACTTTGAACTCATGTCCTACCGGCTTAGCACCCAG - UNI3492

3 - GTCAAACCCCTGATCTGGATCGAGTCAGTCATTGAGAAATTCTCGCACAGCCGAGTGGAGATCATGGTGAAG - UNI34923 - GCCAAGGGTC

AGTTTAAGAAGCAGTCGGTGGCCAATGGCGTGGAAATCTCTGTGCCCGTTCCTAGTGATGCAGACTCTCCGCGCTTCAAGACCAGTGTGGGCAGTGCCAA

GTATGTGCCTGAGAAGAATGTTGTCATCTGGAGCATCAAGTCATTCCCT - UNI34923 - GGGGGAAAGGAGTACTTGATGCGTGCCCACTTTGGCC

TCCCCAGCGTGGAAACTGAGGAGGTAGAGGGCCGACCACCCATCGGGGTCAAGTTTGAGATTCCATACTTTACCGTTTCTGGCATCCAG GTCCGTTACA

TGAAGATCATCGAGAAAAGTGGGTACCAGGCCCTGCCCTGGGTCCGTTACATCACGCAGAGTGGTG ATTATCAACTTCGTACCAGCTAGAAGGGAGAAG

AAGTGGGGCTTCCATCTCCCCAGATACCAGCTGCAGACTTTTAAGAGCTGTGTGTGTGTGTTTGTGAGTGTGCACACGCGAGTGTGTGCAGGGTTAGGGC

ACTGACTTAACACATCCTTGCTGCCCACACCTAACCCCCTTTACCTCTCTCAGCCATCTGGGGTGGTTTCTTTGTGTCCCACCCTAATTTTATATGAAGA

AATATAAGAGGGCCTGAACTCTGCTGCCCGGCCCGCCCCCCATGAGTGCCTTCTTGCAGTAAACTGCCTTGGGCAGATCTAGGGCCCACCTTTTATAGCT

GCTGAGCCGAGGCCACTGGTCCTCCATCTGGGTTTTAGGGTGTCATTAAAATGAATCTAAC
Translation
MSASAVFILDVKGK PLISRNYKGDVPMTEIDHFMPLLMQREEEGVLAPLLSHGRVHFLWIKHSNLYL LVATTLKNANASLVYSFLYKTVE VFCEYFK

ELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQGNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLL VNANGSVLLSEIV

GTIKLKVFLSGMPELRLGLNDRVLFELTGL LSGSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQ - UNI34923 - VKPLI

WIESVIEKFSHSRVEIMVK - UNI34923 - AKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNVVIWSIKSFP - UNI34923 - 

GGKEYLMRAHFGLPSVETEEVEGRPPIGVKFEIPYFTVSGIQ VRYMKIIEKSGYQALPWVRYITQSGD DYQLRTS

For any suggestions or comments, please send an email to unitrap@crg.es