Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003418 (St8sia6)
Chromosomal location
Chr 2: 13576567 - 13715689 (-)
Description
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6 Gene [Source:MGI (curated);Acc:St8sia6-001]
RefSeq_dna
NM_145838 
RefSeq_peptide
NP_665837.1 
UniGene
Mm.330004 Mm.403082 Mm.472559 
MGI
MGI:2386797 
Uniprot/SWISSPROT
Q8K4T1 
Uniprot/SPTREMBL
Q148N5 Q3T9N4 Q8BI43 
Human Ortholog
ENSG00000148488 (ST8SIA6)
Omim not available
UniTrap UNI36392
Vector Insertion
Chr 2: 13645069 - 13714480
Public Clones IST14730C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34494
Vector Insertion
Chr 2: 13594109 - 13618542
Public Clones IST12612A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33607
Vector Insertion
Chr 2: 13576566 - 13587140
Public Clones (sanger) IST13883E12 (tigm) IST12995F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003509
Sequence
GTTTGCAAACTTTTTGAAGTGGGTCCTTTCTGCTCTTCTCTTCAGTCCTCCAGGTTCTAGCTCAGGGCCTCAGCTACATAGCAGAGTCGCAATGTGATTG

GGTGGGTCACTTGGGGCCAAGCGCGCACTCGGGCGAAGGTGAGAGCAGCTGAAAAGTTGGAGCCCAATCAGCGCGGAGTTGAGCGCTCATACCCCAACCT

TCAGGTGACCCCGCGTGGCGGCGGCGGCAGCAGTAGGCAGAGGCAGCGGCGGCTGCAGCGACCAGAGCCCGCAGCGGCTCCGAGCGCCTCCGGGAGGACA

AGCGACGAGCTTGGAGAATCGTCATCCGCTAGCTGTCCGCCAGCTTCGCCAGCTTCGGCGGCCGGGGCTGGCTTGGAAGAAGCGAGCGAGCCCGAACGCG

GCTTCTTCGGCTCGGTGCCCAGCAACACTGTTGCAGGCTGGGCTCTGGGCAGCCCCCAGAGTGCGGGCCCGCGCCACCGCCTTTGAACGCTGGGGGTGTG

CGTGGCAGCGGCCGCGGTGGCGGCGGCGGCGAAGGCGGTGACCGGAGCGGCGAGTCGGTGCCGCCCGGGCTGCGCTTCGCCCCGGCAGCTTTGGCGGCGA

GGACGCCCGTGGCTCAGGATGAGATCGGGGGGCACGCTGTTCGCCCTCATAGGCAGCCTGATGCTGCTGCTCCTCCTGCGTATGCTCTGGTGCCCAGCCG

ACGCGCCTGCCCGCTCCAG GCTGTTGATGGAGGGAAGCAGAGAGGACACCAGTGGTACCTCAGCTGCACTGAAGACACTCTGGAGCCCGACAACCCCGG

TACCACGCACCAGGAACAG CACATATCTGGATGAGAAGACAACCCAAATAACAGAGAAATGCAAAGATCTGCAATATAGCTTGAACTCTTTATCTAACA

AAACGAGACG GTACTCTGAGGATGACTACCTCCAGACCATCACAAACATACAGAGATGCCCATGGAACCGGCAAGCAGAAGAATATGACAATTTTAG A

GCAAAACTGGCTTCCTGTTGCGATGCCATTCAAGACTTCGTGGTTTCCCAGAACAACACTCCAGTGGGGACTAACATGAGCTACGAGGTGGAAAGCAAGA

AACACATCCCCATTCGAGAGAACATTTTCCACATGTTTCCAGTG TCGCAGCCTTTTGTGGACTATCCCTATAACCAGTGTGCAGTGGTTGGTAATGGGG

GAATTCTCAACAAGTCTCTCTGCGGAGCAGAAATTGATAAATCTGACTTCGTCTTCAG - UNI33607 - GTGTAACCTCCCCCCAATCACAGGGAGC

GCTAGTAAAGATGTTGGAAGCAAAACAAATCTTGTGACTGTCAATCCCAGCATTATAACCCTGAA - UNI33607 - GTACCAGAATTTGAAGGAGAA

GAAAGCACAGTTTTTGGAGGACATCTCCACCTATGGAGATGCATTCCTCCTCCTGCCAGCATTTTCCTATCGGGCCAACACAGGCATCTCTTTTAAAGTC

TACCAAACACTCAAAGAGTCAAAAATGAGGCAAAAGGTTCTCTTCTTCCATCCCAGGTACCTGAGACACCTCGCTCTTTTCTGGAGAACTAAAGGGGTGA

CTGCATACCGCTTGTCCACAGGCTTGATGATTGCAAGTGTCGCTGTGGAACTGTGTGAAAACGTGAAGCTCTACGGATTCTGGCCTTTCTCTAAGACTAT

CGAAGACACCCCACTCAGTCACCACTACTATGATAACATGTTACCTAAGCATGGTTTCCACCAGATGCCTAAAGAATACAGCCAAATGCTCCAGCTCCAT

ATGAGAGGAATCCTCAAACTGCAATTCAGCAAATGTGAAACGGCTTAACGTTTCTTAGAAGGAGAATAATTTCAGGAGGTGGAGTGGATGTGTCACAGCA

TCTCCAAAAAGCCAATAGAAGAAGGCACAGAGAAAGCATGAATTACAAAGGCGCTCTCCCACTTGTCTAGACCAAAGCCACCCGCCCCCACTCACTTTGC

AGCCTCCACGAGTCACTCATTCTCACCTTCAACGTTCTTTCTCTGAGAATAGAGACCAAAACATCAGACTTGGATAAGTAAAATGAGATAATTTTTCAAA

TCATCATAGAATTTGATTTGAGCCAGGGTCTCTCAGAATGCTTCCTTGTTCCTATCCATGATAGCCATTCCCACCTTTATCAGAGTGGTAATGAAACTGT

GCAATTGTGCCAAAGACCCTTTCTGAAGAGAATGTCTGAATCATGCGCCGAGTTTTTACACACAGCTCTTCCTTTATAAATAAATCCTTCCCATTCTCCC

TCCTAGTAGAGTACAGAAACAAAATACCCTTGATGATTCAGGAAGAAAAGTCTTTTTTACTTAGCAATGTGCCTGCTTCTGATTCAGTTCGCTTGTGACA

TTAAGCTGGGTTGGGGTTTTGGTTGGATTTGGGGCGTTTCTTCACTTCTTTTGTCTATATTTTCCTTACCTTTATCAGTTTGTATTCGAGCTTCCTGCTT

TGGGATTCTGCAATTCTCTCTCCCACTGACAGGATCAACTCAATGACATAAAGTAGTTCAAACATCCATTGCTTCTCACATGTTTTATCCATAAAGTTAC

TCATCTGATTTTATTTAAAATAGTGAACATCTACTTGATATCAGACCCGAGGACCATCCTCCATTGGAGAATATGAAGATATTGTCACTGGCAGAAAAGC

AGGTGTGTGCCATTAATTGATAAGATACCACAAGCATCATCATGCCAGTTATGAACACAGTGCTGAAAGGATCATAGACAGGGGTGGTTAAATCTGATCC

CAGTAGAATAAACTTCAGTGTACCTATTTCAGGGAAGAGTTAATTTCACAATTAAAACTAGTAAATGAACCAATTCTTAGGCACATTAAGTGGATTCTGA

GTAAAAGAAAGGGAACAGCAGGAGAAAGCTGTTCGCTTGGTTCTGATTACCCAAATGAGCATGCTGGAAGGAGGTTGTGAGGCTACGCTAAAACCTCTGC

GTAGGGAGAGAGTACAGTGCATGAGTGTGGCGGCTTTTGTCCACACTCGTGAAGGGTGAGTAATTCAGAGCCAATCACATCACAAGGATGGACACACCTA

ACTCATCACTTCAGGGGGAGATGAATGCTTTCATGAGAAATTACACTCATAAGCTAAGCATCAGTTTTGAGTAAAATTTGAGTAGATGTTAAATATGAAC

ATTTTATACCTCTTACTAATGTCCCACCGACACCTTTTAATGTAAGCACATTTATTTATTAAGTTACTTGACATTAAATGCTTATGTCTGTATATTCTGT

TCATCCATCGATTTTCCCAAAAAGTAAGAGCATAGGAGATGAGGCCTACATGCCAAGAAAACTATAAATTTTACTCTTTAATTCTTACTTGAGCCAGCTT

GTTGTTTATCAAGTGCTTTTTTGAAGAGACAGCACCCTGTGAATTCTTCATTCTGATACAGTGTCACCTTGTATTTAACATTTGTAATGTTGTTTCAAGT

TTACATCTCTTTCATTCTTTTATAGCAAATCAAACGTATTAGCTTCAGAAATTTATCAGAAGTTCATATATAAATATTTTGCAAAGGGTAAAAGGCTTTT

TTGTTAAATAAAATAAAATTTATTATTTTCTTCTGATGAATAGAGGCTCTTTTATGCTGCTGCTAATGAACCTAATTAGCTTTAAATTATCTCCTAGCAA

CATTGGTCACGTTTCAATCATGCTATTAGC
Translation
MRSGGTLFALIGSLMLLLLLRMLWCPADAPARSR RLLMEGSREDTSGTSAALKTLWSPTTPVPRTRNS STYLDEKTTQITEKCKDLQYSLNSLSNKTR

R RYSEDDYLQTITNIQRCPWNRQAEEYDNFR RAKLASCCDAIQDFVVSQNNTPVGTNMSYEVESKKHIPIRENIFHMFPV SQPFVDYPYNQCAVVGN

GGILNKSLCGAEIDKSDFVFR - UNI33607 - RCNLPPITGSASKDVGSKTNLVTVNPSIITLK - UNI33607 - KYQNLKEKKAQFLEDISTY

GDAFLLLPAFSYRANTGISFKVYQTLKESKMRQKVLFFHPRYLRHLALFWRTKGVTAYRLSTGLMIASVAVELCENVKLYGFWPFSKTIEDTPLSHHYYD

NMLPKHGFHQMPKEYSQMLQLHMRGILKLQFSKCETA

For any suggestions or comments, please send an email to unitrap@crg.es