Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003435 (Supt5h)
Chromosomal location
Chr 7: 29099917 - 29123738 (-)
Description
suppressor of Ty 5 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1202400]
RefSeq_dna
NM_013676 
RefSeq_peptide
NP_038704.1 
UniGene
Mm.285906 
MGI
MGI:1202400 
Uniprot/SWISSPROT
O55201 
Human Ortholog
ENSG00000196235 (SUPT5H)
Omim not available
UniTrap UNI2539
Vector Insertion
Chr 7: 29123455 - 29123713
Public Clones XS0525 (sanger)
Private Clones OST415862 (lexicon) OST285816 (lexicon) OST188737 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7268
Vector Insertion
Chr 7: 29116549 - 29123370
Public Clones XG856 (baygenomics) RRT272 (baygenomics) IST14701F9 (tigm) IST14581A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15705
Vector Insertion
Chr 7: 29114601 - 29115049
Public Clones PST3128-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17341
Vector Insertion
Chr 7: 29109002 - 29110968
Public Clones (ggtc) PST23553-NL (escells)
Private Clones OST444599 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6136
Vector Insertion
Chr 7: 29103884 - 29103973
Public Clones YHD375 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6092
Vector Insertion
Chr 7: 29102841 - 29103757
Public Clones YHD196 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23558
Vector Insertion
Chr 7: 29100290 - 29100367
Public Clones not available
Private Clones OST253429 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003527
Sequence
GGAAGCTTCAGGTGGCAAGCGATCG - UNI2539 - CTGCGGAAGATGTCGGACAGCGAAGACAGCAACTTCTCCGAGGAGGAGGACAGCGAGCGCAG

CAGCGAGGCGGAGGAGGCCGAG - UNI7268 - GTTGAGGAAGACCAGCGAAGTGCTGCAGGCAGTGAAAAAGAGGAGGAGCCTGAGGAAGAGGAGGA

GGAAGAGGAAGAATACGATGAGGAAGAAGAGGAGGAAGATGATGATAGGCCCCCCAAGAAACCACGCCATGGGGGCTTCATTTTAGATGAGGCTG ATGT

AGATGATGAATATGAAGATGAAGACCAGTGGGAAGATGGAGCTGAAGATATCCTGGAGAAAG - UNI15705 - AAGAGATTGAAG - UNI15705 

- CCTCCAATATTGATAACGTTGTGCTGGATGAAGACCGCTCTGGGGCTCGTCGTCTGCAGAATCTCTGGAG - UNI15705 - GGACCAGAGAGAAG

AAGAACTGGGCGAGTATTACATGAAGAAATATGCTAAGTCGTCTGTGGGAGAGAC GGTGTATGGAGGGTCTGACGAGCTCTCAGATGACATCACTCAGC

AGCAGCTGCTCCCAGGAGTCAA GGACCCCAACCTGTGGACTGTCAAGTGTAAG ATTGGGGAGGAACGAGCCACGGCAATTTCCTTGATGCGGAAATTC

ATCGCTTACCAGTTCACAGACACA CCCCTGCAGATTAAGTCAGTGGTTGCCCCTGAGCACGTGAAGGGCTACATCTATGTGGAGGCCTACAAACAGACC

CATGTGAAGCAGGCCATTGAAGGTGTGGGCAACCTGCGGCTTGGCTACTGGAACCAGCAGATGGTGCCTATTAAGGAGATGACCGATGTACTCAAGGTGG

TGAAGGAGGTGGCCAACCTGAAGCCGAAGTCCTGGGTCCGCCTCAAGCGAGGCATCTACAAAGATGACATTGCTCAG - UNI17341 - GTGGACTAT

GTGGAGCCCAGCCAGAACACCATTTCCCTGAAGATGATCCCGCGCATCGACTACGACCGCATCAAAGCCCGAATGAGCCTG AAAGACTGGTTTGCCAAA

AGGAAGAAGTTCAAGCGGCCTCCACAGAGGCTCTTTGATGCAGAGAAGATCAG GTCCTTGGGGGGTGATGTTGCCTCTGATGGTGACTTCCTCATCTTT

GAGGGGAACCGCTACAGCCGAAAGGGCTTCCTGTTCAAGAGCTTTGCCATGTCTGCTGTG ATTACAGAAGGTGTGAAGCCCACACTGTCAGAGCTGGAA

AAGTTTGAAGATCAGCCTGAGGGCATCGACCTGGAGGTTGTGACTGAAAGCACAG GGAAGGAGCGGGAACACAATTTCCAGCCTGGGGACAATGTGGAG

GTGTGCGAGGGCGAGCTCATCAACCTACAGGGCAAGGTCCTCAGCGTGGATGGCAACAAGATCACTATCATGCCCAAGCACGAGGACCTCAAG GACATG

CTTGAGTTCCCCGCTCAGGAACTTCGGAAGTACTTCAAGATGGGGGACCACGTAAAAGTGATTGCTGGCCGATTTGAGGGTGACACAGGTCTCATTGTGC

GGGTGGAAGAGAACTTTGTTATTCTCTTTTCAGACCTCACCATGCATGAG TTGAAAGTGCTTCCCCGAGACCTGCAGCTCTGCTCAGAGACAGCCTCAG

GCGTGGATGTTGGGGGCCAGCATGAGTGGGGTGAGCTGGTGCAGCTGGATCCCCGTACTGTGGGTGTCATCGTGCGGCTAGAGCGAGAAACCTTCCAG G

TTCTCAACATGCACGGGAAGGTGGTGACCGTTAGGCACCAGGCCGTGACGCAGAAGAAGGACAACCGCTTCGCTGTGGCTCTGGACTCGGATCAGAACAA

CATCCATGTGAAGGACATTGTCAAGGTCATCGATGGCCCTCACTCA - UNI6136 - GGCCGAGAGGGTGAGATCCGCCATCTGTACCGCAGCTTTGC

CTTCCTGCACTGCAAGAAGCTGGTGGAGAACGGCGGCATGTTTGTCTGTAAGGCACGGCACCTGGTGTTGGCTGGGGGCTCAAAG - UNI6092 - CC

CCGGGATGTGACCAATTTAACTGTTGGTGGCTTCACTCCTATGAGCCCCCGGATCAGCAGCCCTATGCACCCCAGTGCTGAAG GTCAGCATGGTGGCTT

TGGAAGCCCAGGTGGCATGAGCAGGGGTCGAGGGAGAAGAGACAATGAACTCATAGGCCAGACTGTGCGTATCTCCCAGGGACCCTACAAAG GCTACAT

TGGTGTGGTGAAGGATGCCACAGAGTCCACGGCCAGAGTAGAACTGCATTCTACCTGCCAGACCATCTCTGTGGATCGCCAGCGGCTCACCACGGT CGA

CTCCCAGCGTCCAGGTGGCATGACCTCTACATATGGACGGACTCCCATGTATGGCTCTCAGACACCCATGTATGGCTCTGGCTCCCGAACACCTATGTAT

GGCTCCCAGACACCTTTGCAGGATG GCAGCCGCACTCCACATTATGGCTCACAGACACCCCTGCATGATGGTAGCCGCACTCCTGCTCAGAGTGGGGCC

TGGGACCCCAACAACCCAAACACGCCTTCCAG GGCTGAGGAGGAATACGAATATGCCTTTGACGACGAACCCACCCCATCCCCACAAGCATATGGGGGA

ACCCCGAATCCCCAAACACCCGGCTACCCAGACCCATCATCCCCCCAGGTCAATCCACAGTACAATCCACAGACACCAGGGACGCCAGCCAT GTACAAC

ACAGACCAGTTCTCCCCCTACGCTGCCCCCTCTCCACAGGGGTCTTACCAGCCCAGCCCCAGCCCCCAGAGCTACCACCAAGTGGCACCAAGTCCAGCAG

GCTATCAGAACACCCATTCCCCAGCCAGCTATCACCCGACACCGTCACCTATGGCCTATCAG GCTAGTCCCAGCCCAAGCCCTGTTGGCTACAGTCCAA

TGACCCCTGGAGCACCTTCTCCTGGAGGTTACAATCCCCACACACCGGGCTCAGGCATTGAGCAGAACTCTAGCGACTGGGTGACCACTGATATCCAGGT

GAAGGTTCGAGACACCTATCTGGACACACAAATAGTGGGGCAGACAGGCGTCATCCGCAGTGTCACG GGAGGCATGTGCTCCGTGTACCTGAAGGACAG

TGAGAAGGTGGTCAGCATCTCCAGTGAACATCTGGAGCCCATCACGCCCACCAAGAACAACAAG - UNI23558 - GTGAAGGTGATTCTGGGTGAGG

ACCGAGAGGCTACCGGGGTCCTACTGAGCATTGATGGTGAGGATGGCATCATCCGCATGGACCTAGAGGACCAGCAGATCAAGATTCTAAACCTCCGCTT

CCTAGGGAAGCTCCTGGAAGCCTGACGCCCAAGTGTGCAGTGCAGACATGGAGCCAGCAGCCCCTCTGGCCTTGTTTGGCCTAGCATGGAACCCTGAGTC

TGGAGCAAGCCAGGGCAATCACTCTGTATTTCCTTTTCCTCCTTCCCTGATACTCTAGGAGTCAGAGCAGAGTCTGAGGAATGTTCCTGCCTTCTTCTGC

AGCCCCAGCTTGACTTTGTGTTCAGGTCTTTCAATAAAGAGAAGCTGTTTG
Translation
 - UNI2539 - MSDSEDSNFSEEEDSERSSEAEEAE - UNI7268 - VEEDQRSAAGSEKEEEPEEEEEEEEEYDEEEEEEDDDRPPKKPRHGGFI

LDEAD DVDDEYEDEDQWEDGAEDILEKE - UNI15705 - EEIEA - UNI15705 - ASNIDNVVLDEDRSGARRLQNLWR - UNI15705 - 

RDQREEELGEYYMKKYAKSSVGET TVYGGSDELSDDITQQQLLPGVK KDPNLWTVKCK IGEERATAISLMRKFIAYQFTDT PLQIKSVVAPEHVKG

YIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQ - UNI17341 - VDYVEPSQNTISLKMIP

RIDYDRIKARMSL KDWFAKRKKFKRPPQRLFDAEKIR RSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAV ITEGVKPTLSELEKFEDQPEGIDL

EVVTESTG GKEREHNFQPGDNVEVCEGELINLQGKVLSVDGNKITIMPKHEDLK DMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVIL

FSDLTMHE LKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPRTVGVIVRLERETFQ VLNMHGKVVTVRHQAVTQKKDNRFAVALDSDQNNIHVKDIV

KVIDGPHS - UNI6136 - GREGEIRHLYRSFAFLHCKKLVENGGMFVCKARHLVLAGGSK - UNI6092 - PRDVTNLTVGGFTPMSPRISSPMH

PSAEG GQHGGFGSPGGMSRGRGRRDNELIGQTVRISQGPYKG GYIGVVKDATESTARVELHSTCQTISVDRQRLTTV VDSQRPGGMTSTYGRTPMYG

SQTPMYGSGSRTPMYGSQTPLQDG GSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSR RAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSP

QVNPQYNPQTPGTPAM MYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQ ASPSPSPVGYSPMTPGAPSPGGYNP

HTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQIVGQTGVIRSVT GGMCSVYLKDSEKVVSISSEHLEPITPTKNNK - UNI23558 - VKVILGEDRE

ATGVLLSIDGEDGIIRMDLEDQQIKILNLRFLGKLLEA

For any suggestions or comments, please send an email to unitrap@crg.es