Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003458 (Ncstn)
Chromosomal location
Chr 1: 173996805 - 174012845 (-)
Description
nicastrin Gene [Source:MGI (curated);Acc:Ncstn-001]
RefSeq_dna
NM_021607 
RefSeq_peptide
NP_067620.2 
UniGene
Mm.218203 
MGI
MGI:1891700 
Uniprot/SWISSPROT
P57716 
Uniprot/SPTREMBL
Q3T9E5 Q3TD54 Q3TDE4 Q3TV74 Q6ZQF2 
Human Ortholog
ENSG00000162736 (NCSTN)
Omim not available
UniTrap UNI29582
Vector Insertion
Chr 1: 174011342 - 174012846
Public Clones (sanger) E324H06 (ggtc) E323E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7482
Vector Insertion
Chr 1: 174005660 - 174011342
Public Clones RRR816 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11339
Vector Insertion
Chr 1: 174001701 - 174002251
Public Clones F038A08 (ggtc) F038A03 (ggtc) F035F08 (ggtc) F035F04 (ggtc) F052C05 (ggtc)
P080H12 (ggtc) F038A01 (ggtc) F013E02 (ggtc) F038A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003550
Sequence
GACCTGAGGCTTCCGCCCAGCGGAGAGGCAAGATGGCTACGACTAGGGGCGGCTCTGGGCCTGACCCAGGAAGTCGGGGTCTTCTTCTTCTGTCTTTTTC

CGTGGTACTGGCAG - UNI29582 - GATTGTGTGGGGGAAACTCAGTGGAGAGGAAAATCTACATTCCCTTAAATAAAACAGCTCCTTGTGTCCGCC

TGCTCAACGCCACTCATCAGATTGGCTGCCAGT - UNI7482 - - UNI29582 - CTTCAATTAGTGGGGATACAGGGGTTATCCATGTAGTGGAG

AAAGAAGAAGACCTGAAGTGGGTGTTGACCGATGGCCCCAACCCCCCTTACATGGTTCTGCTGGAGGGCAAGCTCTTCACCAG AGATGTAATGGAGAAG

CTGAAGGGAACAACCAGTAGAATCGCTGGTCTTGCCGTGACTCTAGCCAAGCCCAACTCAACTTCAAGCTTCTCTCCTAGTGTGCAGTGCCCAAATGATG

GGTTTG GTATTTACTCCAACTCCTACGGGCCAGAGTTTGCTCACTGCAAGAAAACACTGTGGAATGAACTGGGCAACGGCTTGGCTTATGAAGACTTTA

GTTTCCCCATCTTTCTTCTTGAAGATGAGAACGAAACCAAGGTCATCAAGCAG TGCTATCAAGATCACAACCTGGGTCAGAATGGCTCTGCACCAAGCT

TCCCATTGTGTGCTATGCAGCTCTTCTCACACATGCACGCCGTCATCAGCACTGCCACCTGCATGCGGCGCAGCTTCATCCAGAGCACCTTCAGCATCAA

CCCAG AAATCGTCTGTGACCCCTTATCCGACTACAACGTATGGAGCATGCTTAAGCCTATAAATACATCTGTGGGACTAGAACCTGACGTCAGGGTTGT

GGTTGCGGCCACACGG CTGGATAGCCGGTCCTTTTTCTGGAATGTGGCCCCAGGGGCTGAAAGTGCTGTAGCCTCCTTTGTCACTCAGCTGGCTGCAGC

TGAAGCTTTGCACAAGGCACCTGATGTGACCACTCTATCCCGAAATGTGATGTTTGTCTTCTTCCAGGGG - UNI11339 - GAAACTTTTGACTACA

TTGGCAGCTCACGGATGGTCTATGATATGGAGAACGGCAAGTTTCCCGTGCGGCTCGAGAACATTGACTCCTTCGTGGAGCTGGGACAG GTGGCCCTAA

GAACTTCACTAGATCTCTGGATGCACACAGATCCCATGTCTCAGAAAAATGAGTCTGTGAAAAACCAG GTGGAGGATCTTCTGGCCACTCTGGAGAAGA

GCGGTGCTGGTGTCCCTGAAGTTGTCCTGAGGAGACTGGCCCAGTCCCAGGCCCTTCCACCTTCGTCTCTACAACGATTTCTTCGGGCTCGAAACATCTC

TGGCGTGGTCCTGGCTGACCACTCTGGCTCCTTCCACAATCG GTATTACCAGAGCATTTATGACACGGCTGAGAACATTAATGTGACCTATCCTGAGTG

GCAGAGCCCAGAAGAGGACCTCAACTTTGTGACAGACACTGCCAAG GCACTGGCGAATGTGGCCACAGTGCTGGCGCGTGCACTGTATGAGCTTGCAGG

AGGAACCAACTTCAGCAGCTCCATCCAGGCTGATCCCCAGACA GTTACACGTCTGCTCTATGGGTTCCTGGTTAGAGCTAACAACTCATGGTTTCAGTC

GATCTTGAAACATGACCTAAGGTCCTATTTGG ATGACAGGCCTCTTCAACACTACATCGCCGTCTCCAGCCCTACCAACACGACTTACGTTGTGCAGTA

CGCCTTGGCAAACCTGACTGGCAAGGCGACCAACCTCACCCGAGAGCAGTGCCAGGATCCAAGTAAAGTCCCAAATGAGAGCAAGGAT TTATATGAATA

CTCGTGGGTACAAGGCCCTTGGAATTCCAACAGGACAGAGAGGCTCCCACAGTGTGTGCGCTCCACAGTGCGACTGGCCAGGGCCTTGTCCCCTGCCTTT

GAACTGAGTCAGTGGAGCTCCACAGAATACTCTACGTGGGCGGAGAGCCGCTGGAAAGACATCCAAGCTCGGATATTCCTAATTGCCAGCAAAGAGCTTG

AG TTCATCACGCTGATCGTGGGCTTCAGCACCCTTGTCTTCTCCCTCATCGTCACCTACTGCATCAATGCCAAAGCCGACGTCCTTTTCGTTGCTCCCC

GAGAGCCAGGAGCTGTGTCTTACTGA
Translation
MATTRGGSGPDPGSRGLLLLSFSVVLAG - UNI29582 - GLCGGNSVERKIYIPLNKTAPCVRLLNATHQIGCQS - UNI7482 - - UNI2958

2 - SSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTR RDVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFG GIYSNSYGPE

FAHCKKTLWNELGNGLAYEDFSFPIFLLEDENETKVIKQ CYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFSINPE EIVCDPLS

DYNVWSMLKPINTSVGLEPDVRVVVAATR LDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRNVMFVFFQG - UNI11339 - ETFDY

IGSSRMVYDMENGKFPVRLENIDSFVELGQ VALRTSLDLWMHTDPMSQKNESVKNQ VEDLLATLEKSGAGVPEVVLRRLAQSQALPPSSLQRFLRARN

ISGVVLADHSGSFHNR RYYQSIYDTAENINVTYPEWQSPEEDLNFVTDTAK ALANVATVLARALYELAGGTNFSSSIQADPQT VTRLLYGFLVRANN

SWFQSILKHDLRSYLD DDRPLQHYIAVSSPTNTTYVVQYALANLTGKATNLTREQCQDPSKVPNESKD LYEYSWVQGPWNSNRTERLPQCVRSTVRLA

RALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELE FITLIVGFSTLVFSLIVTYCINAKADVLFVAPREPGAVSY

For any suggestions or comments, please send an email to unitrap@crg.es