Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003573 (Homer3)
Chromosomal location
Chr 8: 72806949 - 72818249 (+)
Description
homer homolog 3 (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1347359]
RefSeq_dna
NM_011984 
RefSeq_peptide
NP_036114.1 
MGI
MGI:1347359 
Uniprot/SWISSPROT
Q99JP6 
Uniprot/SPTREMBL
Q501M9 
Human Ortholog
ENSG00000051128 (HOMER3)
Omim not available
UniTrap UNI18179
Vector Insertion
Chr 8: 72807000 - 72809132
Public Clones not available
Private Clones OST428213 (lexicon) OST311050 (lexicon) OST278291 (lexicon) OST274630 (lexicon)
OST153625 (lexicon) OST119077 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23959
Vector Insertion
Chr 8: 72809215 - 72809292
Public Clones not available
Private Clones OST239343 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23123
Vector Insertion
Chr 8: 72809450 - 72809829
Public Clones not available
Private Clones OST275712 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000087467
Sequence
GCGGGGCGCGCGGAGGGCGCGGGCCGGAGGCTGCAGCGACGACGACGCGGG - UNI18179 - GGGACAAACAAGTGACTCCTGTCACCCCTCTGGGT

GCCCCTTAGAGGCCATCCAGCCCAACCTGACCAATGTCCACAGCCAG - UNI23959 - GGAACAGCCAATCTTCAGCACCCGGGCGCACGTATTCCA

GATCGACCCCACTACAAAGCGGAACTGGATCCCCGCCGGCAAGCACGCACTTACCGTGTCCTATTTCTATGATGCAACCCGAAATGTGTACCGCATCATC

AGCATCGGGGGTGCCAAG - UNI23123 - GCCATCATCAACAGCACTGTCACTCCCAACATGACCTTCACCAAAACCTCTCAGAAGTTCGGGCAATG

GGCAGACAGTCGAGCCAACACTGTCTACGGCCTAGGCTTTGCCTCTGAACAGCAGCTGACCCAG ATATATTTGTATGCGTTTGTGTGCATTTGCATGCA

TTTGTATGTGCACAGGCCATGTGTGTGCTGA
Translation
 - UNI18179 - MSTAR - UNI23959 - REQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAK - UNI23123 - 

AIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQ IYLYAFVCICMHLYVHRPCVC
Transcript ENSMUST00000003669
Sequence
GCGGGGCGCGCGGAGGGCGCGGGCCGGAGGCTGCAGCGACGACGACGCGGG - UNI18179 - GGGACAAACAAGTGACTCCTGTCACCCCTCTGGGT

GCCCCTTAGAGGCCATCCAGCCCAACCTGACCAATGTCCACAGCCAG - UNI23959 - GGAACAGCCAATCTTCAGCACCCGGGCGCACGTATTCCA

GATCGACCCCACTACAAAGCGGAACTGGATCCCCGCCGGCAAGCACGCACTTACCGTGTCCTATTTCTATGATGCAACCCGAAATGTGTACCGCATCATC

AGCATCGGGGGTGCCAAG - UNI23123 - GCCATCATCAACAGCACTGTCACTCCCAACATGACCTTCACCAAAACCTCTCAGAAGTTCGGGCAATG

GGCAGACAGTCGAGCCAACACTGTCTACGGCCTAGGCTTTGCCTCTGAACAGCAGCTGACCCAG TTTGCTGAGAAGTTTCAGGAGGTGAAAGAAGCTGC

CAGGCTGGCTCGAGAGAAATCTCAAGATGGTGGAGAATTCACTAGTACTGGCCTGGCCCTTGCCTCCCATCAG GTTCCTCCAAGCCCCTTGGTCAGCAC

CAATGGTCCAGGCGAGGAAAAGCTGTTCCGTAGCCAGAGTGCGGACACCCCTGGCCCCACCGAGCGGGAACGGTTGAAGAAGATGCTGTCAGAAGG CTC

TGTAGGGGAGGTCCAGTGGGAGGCAGAGTTCTTCGCGCTTCAGGACAGCAACCAGAGGTTGGCGGGAGCCCTTCGGGAGGCCAACGCAGCGGCCACTCAG

TGGAGGCAACAACTGGAGGTCCAACGTGCAGAGGCTGAACTCTTGAGGCAGCGG GTAGCAGAGCTGGAGGCCCAGGTGGCTGTAGAGCCAGTCCGGGCA

GGAGAGAAAGAAGCAACCAGCCAGTCGGTGGAGCAGCTGGAGGCTCGGGTGCAGACCAAGGACCAG ACTTTGAAGAATCAGAGCACTGGCACCCGAGAG

GCTCCAGACACTGCCGAGCGCGAAGAGACACAGCAGCAAGTTCAG GACCTGGAGACCCGGAATGCAGAGCTGGAGCAGCAGCTGCGGTCGATGGAGTGC

AACCTGGAGGAGGCGCGGGCCGAGCGGGAGCGCGCACGGGCGGAGGTGGGCCGGGCTGCGCAGCTGCTGGATGTTCGGCTGTTTGAGCTCAGCGAGCTGC

GTGAAGGCCTGGCACGCCTGGCAGAGGCAGCACCCTAGTCTGCCATGGAGTGTCTGCGGCCTCAAGGCGCCCTGGCAGGGGCCAGGGGACCCCAGCTGTC

TCTGAGCTTTGCACTGTGTAGAGTTTTCTAGAATCCTTGGGCAGTGCTTCTACCCAGGTTACATTTCTACGTGTGGCGTTGCTGTCCCTGGCTGCTGCTG

CCCTGCGCCCCAGGGACACTGCGAGGGAAGGCTGCACTAGTCATCCCCATGGGGCAACAGAGGCTTTGGGATCCTGAGACCTGAAGGCCCTGTACTCATC

CCACCCCATTCTCAAGTCAGACTGACAACTTCAAAGAGTGTTTACTGAAGTCAGGGGCCACCAGCACCAGGTTTACAGCTCAGTCCTGAGCCTCAGCCTG

GGCTGGCTCTTGGGGCCGAGATCTGGGAGGACGCGACCGTCGGACAGTGCTCCCTGCTTTCTGCCGCCGAAGTGTCTGCCCCACTTTCTCCTTGAAGCGT

CGGTTTTGTTGCTTGATCTTGGCCAGCTCAGCTTTGCGTTTGGCCTCCAGGTCTGGGTCCTGCGGAAGGGAGCTGAGAATGTAACTGGGCAGCTTCCCAG

GGACTGGCTCCCCCACCCCTACCCGACCCCAGGTCCCACCCACCCTTACTGGCCACACTCTTATGCCTGTCCCTGCATACCCATGCCTCCCTATACTACC

TTCCCCTCCAGGATCATCTGTTTCCGCTTGTTGATCTCTTTCTTTTCATCAAAATGCGAAGCCTCCAGTTTCTAGGGGTGGGGAGGGGAACAGGTCAGTC

AGGCCTGGGGCAGGAAGCCCCGCCCACCTCACCCCACTCCACCCTACCCTGACAGGCTGGCCACACTTACTATTTCGCACTCCCTTCGCACTACGTTGAC

CTGCGTGAGGATTTGTAGAACCTCAGCCTCCTCCACCACCAGCTCTGCCAGCTGCTGCTCTGCAGGGACAGGAAACACTGAGTTGGGCTGGGAGTGCAAC

CAGCCCTCTGCACCCCCAGCTCTGGATGTCTGGATCCAACCAAATGTGGACTGATGATATTTAGAAAAAGCAAAATGCTGCCAAGCTTGGCAGCACATGC

TTGTCATCACAGCACTGGGAGGTTGGAGGCAGGGGGATCACTCGTTCCAGCTGAGTTCCAGGCCAGCTCTGTAGAGCAAGAATCTGTCTCAAATTAATGA

CTGAATAAACAAATGAACAAGT
Translation
 - UNI18179 - MSTAR - UNI23959 - REQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAK - UNI23123 - 

AIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQ FAEKFQEVKEAARLAREKSQDGGEFTSTGLALASHQ VPPSPLVSTNGPGEEKLF

RSQSADTPGPTERERLKKMLSEG GSVGEVQWEAEFFALQDSNQRLAGALREANAAATQWRQQLEVQRAEAELLRQR VAELEAQVAVEPVRAGEKEATS

QSVEQLEARVQTKDQ TLKNQSTGTREAPDTAEREETQQQVQ DLETRNAELEQQLRSMECNLEEARAERERARAEVGRAAQLLDVRLFELSELREGLAR

LAEAAP
Transcript ENSMUST00000110124
Sequence
GCGGGGCGCGCGGAGGGCGCGGGCCGGAGGCTGCAGCGACGACGACGCGGG - UNI18179 - GGGACAAACAAGTGACTCCTGTCACCCCTCTGGGT

GCCCCTTAGAGGCCATCCAGCCCAACCTGACCAATGTCCACAGCCAG - UNI23959 - GGAACAGCCAATCTTCAGCACCCGGGCGCACGTATTCCA

GATCGACCCCACTACAAAGCGGAACTGGATCCCCGCCGGCAAGCACGCACTTACCGTGTCCTATTTCTATGATGCAACCCGAAATGTGTACCGCATCATC

AGCATCGGGGGTGCCAAG - UNI23123 - GCCATCATCAACAGCACTGTCACTCCCAACATGACCTTCACCAAAACCTCTCAGAAGTTCGGGCAATG

GGCAGACAGTCGAGCCAACACTGTCTACGGCCTAGGCTTTGCCTCTGAACAGCAGCTGACCCAG TTTGCTGAGAAGTTTCAGGAGGTGAAAGAAGCTGC

CAGGCTGGCTCGAGAGAAATCTCAAGATGGTGGAGAATTCACTAGTACTGGCCTGGCCCTTGCCTCCCATCAG GTTCCTCCAAGCCCCTTGGTCAGCAC

CAATGGTCCAGGCGAGGAAAAGCTGTTCCGTAGCCAGAGTGCGGACACCCCTGGCCCCACCGAGCGGGAACGGTTGAAGAAGATGCTGTCAGAAGG CTC

TGTAGGGGAGGTCCAGTGGGAGGCAGAGTTCTTCGCGCTTCAGGACAGCAACCAGAGGTTGGCGGGAGCCCTTCGGGAGGCCAACGCAGCGGCCACTCAG

TGGAGGCAACAACTGGAGGTCCAACGTGCAGAGGCTGAACTCTTGAGGCAGCGG GTAGCAGAGCTGGAGGCCCAGGTGGCTGTAGAGCCAGTCCGGGCA

GGAGAGAAAGAAGCAACCAGCCAGTCGGTGGAGCAGCTGGAGGCTCGGGTGCAGACCAAGGACCAG GAGATCCAGACTTTGAAGAATCAGAGCACTGGC

ACCCGAGAGGCTCCAGACACTGCCGAGCGCGAAGAGACACAGCAGCAAGTTCAG GACCTGGAGACCCGGAATGCAGAGCTGGAGCAGCAGCTGCGGTCG

ATGGAGTGCAACCTGGAGGAGGCGCGGGCCGAGCGGGAGCGCGCACGGGCGGAGGTGGGCCGGGCTGCGCAGCTGCTGGATGTTCGGCTGTTTGAGCTCA

GCGAGCTGCGTGAAGGCCTGGCACGCCTGGCAGAGGCAGCACCCTAGTCTGCCATGGAGTGTCTGCGGCCTCAAGGCGCCCTGGCAGGGGCCAGGGGACC

CCAGCTGTCTCTGAGCTTTGCACTGTGTAGAGTTTTCTAGAATCCTTGGGCAGTGCTTCTACCCAGGTTACATTTCTACGTGTGGCGTTGCTGTCCCTGG

CTGCTGCTGCCCTGCGCCCCAGGGACACTGCGAGGGAAGGCTGCACTAGTCATCCCCATGGGGCAACAGAGGCTTTGGGATCCTGAGACCTGAAGGCCCT

GTACTCATCCCACCCCATTCTCAAGTCAGACTGACAACTTCAAAGAGTGTTTACTGAAGTCAGGGGCCACCAGCACCAGGTTTACAGCTCAGTCCTGAGC

CTCAGCCTGGGCTGGCTCTTGGGGCCGAGATCTGGGAGGACGCGACCGTCGGACAGTGCTCCCTGCTTTCTGCCGCCGAAGTGTCTGCCCCACTTTCTCC

TTGAAGCGTCGGTTTTGTTGCTTGATCTTGGCCAGCTCAGCTTTGCGTTTGGCCTCCAGGTCTGGGTCCTGCGGAAGGGAGCTGAGAATGTAACTGGGCA

GCTTCCCAGGGACTGGCTCCCCCACCCCTACCCGACCCCAGGTCCCACCCACCCTTACTGGCCACACTCTTATGCCTGTCCCTGCATACCCATGCCTCCC

TATACTACCTTCCCCTCCAGGATCATCTGTTTCCGCTTGTTGATCTCTTTCTTTTCATCAAAATGCGAAGCCTCCAGTTTCTAGGGGTGGGGAGGGGAAC

AGGTCAGTCAGGCCTGGGGCAGGAAGCCCCGCCCACCTCACCCCACTCCACCCTACCCTGACAGGCTGGCCACACTTACTATTTCGCACTCCCTTCGCAC

TACGTTGACCTGCGTGAGGATTTGTAGAACCTCAGCCTCCTCCACCACCAGCTCTGCCAGCTGCTGCTCTGCAGGGACAGGAAACACTGAGTTGGGCTGG

GAGTGCAACCAGCCCTCTGCACCCCCAGCTCTGGATGTCTGGATCCAACCAAATGTGGACTGATGATATTTAGAAAAAGCAAAATGCTGCCAAGCTTGGC

AGCACATGCTTGTCATCACAGCACTGGGAGGTTGGAGGCAGGGGGATCACTCGTTCCAGCTGAGTTCCAGGCCAGCTCTGTAGAGCAAGAATCTGTCTCA

AATTAATGACTGAATAAACAAATGAACAAGT
Translation
 - UNI18179 - MSTAR - UNI23959 - REQPIFSTRAHVFQIDPTTKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAK - UNI23123 - 

AIINSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQQLTQ FAEKFQEVKEAARLAREKSQDGGEFTSTGLALASHQ VPPSPLVSTNGPGEEKLF

RSQSADTPGPTERERLKKMLSEG GSVGEVQWEAEFFALQDSNQRLAGALREANAAATQWRQQLEVQRAEAELLRQR VAELEAQVAVEPVRAGEKEATS

QSVEQLEARVQTKDQ EIQTLKNQSTGTREAPDTAEREETQQQVQ DLETRNAELEQQLRSMECNLEEARAERERARAEVGRAAQLLDVRLFELSELREG

LARLAEAAP

For any suggestions or comments, please send an email to unitrap@crg.es