Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003575 (Crtc1)
Chromosomal location
Chr 8: 72906256 - 72963469 (-)
Description
CREB regulated transcription coactivator 1 Gene [Source:MGI (curated);Acc:Crtc1-001]
RefSeq_dna
NM_001004062 
RefSeq_peptide
NP_001004062.1 
UniGene
Mm.227767 Mm.397822 Mm.409061 
MGI
MGI:2142523 
Uniprot/SWISSPROT
Q68ED7 
Human Ortholog
ENSG00000105662 (CRTC1)
Omim not available
UniTrap UNI9105
Vector Insertion
Chr 8: 72929220 - 72929976
Public Clones XK522 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076615
Sequence
GGCGGCGAGAAGATGGCGACTTCGAACAATCCGCGGAAATTTAGCGAGAAGATCGCACTGCACAACCAGAAGCAGGCGGAGGAGACGGCGGCCTTCGAGG

AGGTCATGAAGGACCTGAGCCTGACGCGGGCCGCGCGG CTTCAGCTGCAGAAGTCCCAGTACCTGCAGCTGGGCCCCAGCCGTGGCCAGTACTACGGTG

GGTCCCTGCCCAACGTGAACCAGATTGGAAGCAGCAGCGTGGACCTGGCCTTCCAG ACCCCATTTCAGTCCTCAGGCCTGGACACGAGTCGGACCACAC

GACATCATGGGCTTGTGGACAGAGTATATCGTGAGCGTGGCAGACTTGGCTCCCCGCACCGTCGACCCCTGTCAGTAGACAAGCATGGGCGACAG - UN

I9105 - GCTGACAGCTGCCCCTATGGCACCGTGTACCTCTCGCCTCCTGCGGACACCAGCTGGAGGAG GACCAACTCTGACTCTGCCCTGCACCAGA

GCACAATGACACCCAGCCAGGCAGAGTCCTTCACAGGCGGGTCCCAGGATGCGCACCAGAAGAGAG TCTTACTGCTAACTGTCCCAGGAATGGAGGACA

CCGGGGCTGAGACAGACAAGACCCTTTCTAAGCAGTCATGGGACTCAAAGAAG GCGGGTTCCAGGCCCAAGTCCTGTGAGGTCCCCGGAATCAA CATC

TTTCCGTCTGCAGACCAGGAGAACACAACAGCCCTGATCCCTGCCACCCACAACACAGGGGGCTCCCTTCCTGACCTCACCAACATCCACTTCCCCTCCC

CACTCCCGACACCACTGGACCCTGAGGAGCCTCCGTTCCCTGCTCTCACCAGCTCCAGCAGCACCGGCAGCCTTGCACATCTGGGCGTTGGCGGCGCAGG

CCAGG GTATGAACACCCCCAGCTCTTCTCCACAGCACCGGCCAGCAGTCGTCAGCCCCCTGTCCCTGAGCACAGAGGCCAGGCGGCAGCAGGCCCAGCA

GGTGTCACCCACCCTGTCTCCGTTGTCACCCATCACTCAG GCCGTGGCTATGGATGCCCTGTCCTTGGAGCAGCAGCTGCCCTATGCCTTCTTCACCCA

GACTGGCTCCCAGCAGCCTCCCCCACAGCCCCAGCCACCGCCTCCACCTCCACCGGTATCCCAGCAGCAGCCACCACCTCCACAGGTGTCTGTGGGCCTC

CCCCAGGGTGGTCCACTGCTGCCCAGTGCCAGCCTGACTCGGGGGCCCCAGCTGCCACCACTCTCAGTTACTGTACCATCCACTCTTCCCCAGTCCCCTA

CAGAGAACCCAGGCCAGTCACCAATGGGGATCGATGCCACTTCG GCACCAGCTCTGCAGTACCGCACGAGTGCAGGGTCACCTGCCACCCAGTCTCCCA

CCTCTCCGGTCTCCAACCAAGGCTTCTCCCCTGGAAGCTCCCCACAG CACACGTCCACCCTGGGCAGCGTGTTTGGGGATGCGTACTATGAGCAGCAGA

TGACAGCCAGGCAGGCCAATGCTCTGTCCCGCCAG CTGGAGCAGTTCAACATGATGGAGAACGCCATCAGCTCCAGCAGCCTATACAACCCGGGCTCCA

CACTCAACTATTCCCAGGCTGCCATGATGGGTCTGAGCGGGAGCCACGGGGGCCTACAGGACCCGCAGCAGCTCGGCTACACAGGCCACGGTGGAATCCC

CAACATCATCCTCACGG TGACAGGAGAGTCACCACCGAGCCTCTCTAAGGAACTGAGCAGCACACTGGCAGGAGTCAGTGATGTCAGCTTTGATTCAGA

CCATCAGTTTCCACTGGACGAGCTGAAGATTGACCCTCTGACCCTGGACGGACTCCATATGTTGAATGACCCAGACATGGTTTTAGCCGACCCAGCCACC

GAGGACACCTTCCGAATGGACCGCCTGTGAGTGGCTGTGCCCACCAGCCGCCGCTGGTCAGTCTCCAACGGCGCTGCCCCAAACCTGGGGACGGCAATGG

CGTCCCCCTTTGCCAACGGCCAAGCTTGTGGTTCTGAGCTTGCAATGCTGCCCAGTGCCCCTGCCAGCCCCCCGCCACCCCGGTCGTTCACCTCCCATGA

TGCCTGGCGTGTGTGAGGCCGCTGTGTACTAGGCTGGCTATCTGTCTGTCCATCCATCTACCTGGGGTCAGGCTGATGGCCGAGGCTGTGAGTGCCTGGC

CCCCATGGATGTTCCCCGTGCTCGCTCCCTCACCCCTCACTGGGGATGTGAGAGCCCTCATCAGATACCCAAAGTGTCACTCACTTCCAGATGTGCTGTG

CAAGGAGGGCCGGGGCGTGGGTGTGGAGCGCCCAGAGGCTTAGGTGCGCCATCCATTCGACTGTTGTCAGCTGTCACTGCCTTCCTCCATCCTGCCCCCC

TCCCCACCGCCATCCCCAGCCCTGGTCAGGTCATGCATGCCCACCGAGCCCAGGGCAAAGACAGCAGAGTGACGGGGCCGACCTGGACCAGAATAAACAC

TGTTTGGATGGCTGCCTTTTATATTCCTGAGCGCTCTTGCAGCGTGACAATCGACCTATGGCCGAATGTGGTATGGACAGAGCCACTGAAGCAGCCAGTG

CCCCTCCTTGGCTCATTCTCACCATCCTTGCCCCCTGTTGGACAAAGGTCAGTATGGTGGCACTGGGATGGAGGGTCACGGGCCACCTGCACATTCTCCT

CACTCTTCCAGCCTCGTGACCTGTCCCTCCTGCTGTTTAGGATCTGGGGCTCGGGAGGCAGCAGCCCTGGTGGTTCTGCTTTTCCTTCCGTTTCTGTTGG

CATTTGGTAGCTGACCCCCCCCCCCCAGACTTGCCTGGCAGCATGTGTTAACTATCCCCCAGTCCCTCCTTTACCTTTTTAAAAGTTAACTGGAATACTA

GCCTGGAGCACTTGCAAGCTGGGGCACCTGGGCTGCTCACCCTGGACCTGGGCGTACTGGCATTTAGTCTCAACTCCAGAGAGCTGGGTGGGCAAGGATG

GGGCTGGATGCAGGGTCCTGGTGGCTGGGCGTGTCTGTAGAACCGCAGAACATATCCTGGGAACAGCCTTTACTTTCACTGGAGCCTCCTGAGAACCCTC

TCTCTCTGAGGATCTTTAAGGCGTCTGCCAGGCCTTAGCAGTGGCTAAGTGGGGGCTGTGGACCGGGGTCACCTTTGGCCTGGAAGTTCTGATCCCCACC

ACCCTAGGTCATAGCTTGACATGCCCTCTGCCTCTGCTCCGTAGGCCCGGGCCGCGGCTTCACTGTTTCTCTGTGCCGTTGCCCACTGCCCATGCTGGGG

GTTTGGGGAGCACACAAGCTGTGTGTGTCTCTCCCCAAGCACCTAGGCAGCCGCCTGCATGAGAAAGCTGCCACCCTTTCATTGCTATTCCCCTTCCCCT

GGGTCTGAAGACACAGCATTGCTTTGTCCAAGTCACCTGTCCAGGTCTCAGGCCTTTCTGTCACCACGGTGCGGACTTGAAGGGAATAGTGGGAACTTTA

TCATCACCATCACCATCATCATCAAACGTATGTGGTGGCACGCGTCTGTCACCCCAGCACTGGCGAGCTGGAAAGCACACAGAAGTGGGGTGGGACTCTC

TTCCAGCTGTAGAAGTCTGAGCAAACGGCCTCAACAGGGCCGAGAGGCTGACAGGGTACCTGGAGTCCAGTTACTCACTGGCTGTCTGAGTTCTCAGTGA

GCCAGGGCAGGACAGATACAGCCCATGGCCCTCCTAAGCTGGTGGCCTGGCTTTCAGTGCCCTGAAGCCAAGAGTGCATGTAGCTGTATTAATGTGACCA

GTTCATTGCCAAGTCCTATGATGAGGTGACACGTCCCTGCCTCAGCGCCCCAGGCAGCTGTGAGCATCTCATGAGCTCTCTGGCCCAGCCAGGAGCCAGC

ACTCGGGTGCATGCATGTTCCCAAAGGGGTCACCCTCCCCTCCCCTGGGCCTAGCTGCTGTCAGGGGGACTCCTGGGAGGTGTCTTTGTTTTCTAGATAT

AGGTCACCTGTCCGATAATACCCCTGTATTGCCAAGACATCCCAAGATGATAGCTCAAGGCCGTGGGGGCCTCAGCTGGTGACATGCAGATACTGTGACC

CATTGAACTGTGCTGGGAGCAGCCACCTTGCAATGTGTACATAGACCCTCTGCCCACATTCATGCTCTCTCAGGACAGGCTTAGACACCTGGCCCTTGAG

AGGTCAGATGCGTGAGCCAGGCCTGGTTTTTTCCCCTCCACCTTACCCATGTGTCACCAGCTTCAGCCAAGCCCCTCCTCAGCCATGTGGCTGTCCAGCC

CACTTCCCTGACTCAGAAACAGGACTGGGGCATCTTGATAACTCTATGCCCAGCTGCCTCAGTTAACCTTGGCAATCTACCCAAAGCCCCACAGAACAAC

AATGCAGCTGGACCCAGCCCCTTTCTATATCCTAAGAAATGGCTTGTCCCCTTGACCCAAGGCCCTGTCATATCCCCTTCCTGCAACACTATCCAGTGTG

GCTCTGGGAAGTCCACTGGTACTTAGCCTAGCCTTCAACTCTTTGGAAGACTCTTACACAGGGGGGCCCCCTAGTGAAACCCATGTGCTACTGCACAGCA

CCCAAGGATGGCTGACAGCTATCACACTGGGCTTGATGTCAAGAGTCCTGGCACTCCGGTCAGGACAAGAACGGGCAAAAGGCATGGGGACAGCAAACCT

GCACCAGTGTCAGCTGCCGTTCTTCTCACAGTGGGCCTGGGGTTTTTTATTTTGCAGAGATTTAGCACAGGTTGAGAGGGCTGCTGGTATCAGGGTCTTG

ATGCAGCTGTGTGCACAGGCATGGGGTTGTAGAGTTGTGCCCTAGGTCTGGCTGCTGTCCCTCAGAGCTGTCCAGGTGAGGACACCGTGGCGCAGTCTAC

CCCATGTGGTCTGCCTCTGGTGTGGTGGTACCTGGTCCTTTTTATACCCCTTCCACCTTGGCTCCCAGGGGGCCTCTTCCTTCAGGGATCTGGTGGGTGA

TTTGGCGACCCTGATCATTTCTGTCTCAGGCATGGCCCTCAGTGTGGCACAAATGCCTGCCACCCATTGGTCATAGCCACATCTCCCTGTCAGGGCAGAA

GATGGAGGGACTTGTATCCTCTCGAGCCTGGGTGCTGGGGTACTCCCAAGGCCATGGGGTGCCCTGAACCTCAGTTTTCCTCTTTCTCAACCCTGCTGGG

CTCAGGGGCCCAACCTCCTGGTCAGGGTAGGGATAGCAGCAGAACCCCCACAATGGGACCAGCAGTCCCTTCTGCACTCAGCCTTTCCTTGGGGCTAGGG

ATCCATCACATGGGGTAAGGCCTAGCCTAATCCAACCCAGCACTTCTGGTCACAGGGGGACATGAGGACAGGGCTGTGGCCATAACTCCAGAGGCCAGGC

TCCTGTTTCTCAGGCCCCATCTCACCCCTTAGTTGGAAAAAGGACGCCATGGGCTGGGGTGCCCCTTTGATATATGCAAATGGCTGGTTCCACATTCCCC

TCCCCGTGCCCAGGCTGGCTCTGCCCCCGGCATGCGCACTCCGCTGCGGATGTCTGTGGATCGTGCGCATGGGCACCGCAGTTGGGGGTCAGGTTGCTCA

GGGCACGCACGGCCGCCCGCCCCACCTTCTGGCGCAGACGCTTCTTTGTATTTTTGCGCCCTTTGTAATGAAATGTAATAAAAACCCAATGTTTTCG
Translation
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAAR LQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSSSVDLAFQ TPFQSSGLDTSRTTRHH

GLVDRVYRERGRLGSPHRRPLSVDKHGRQ - UNI9105 - ADSCPYGTVYLSPPADTSWRR RTNSDSALHQSTMTPSQAESFTGGSQDAHQKRV VL

LLTVPGMEDTGAETDKTLSKQSWDSKK AGSRPKSCEVPGIN NIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPPFPALTSSSST

GSLAHLGVGGAGQG GMNTPSSSPQHRPAVVSPLSLSTEARRQQAQQVSPTLSPLSPITQ AVAMDALSLEQQLPYAFFTQTGSQQPPPQPQPPPPPPPV

SQQQPPPPQVSVGLPQGGPLLPSASLTRGPQLPPLSVTVPSTLPQSPTENPGQSPMGIDATS APALQYRTSAGSPATQSPTSPVSNQGFSPGSSPQ HT

STLGSVFGDAYYEQQMTARQANALSRQ LEQFNMMENAISSSSLYNPGSTLNYSQAAMMGLSGSHGGLQDPQQLGYTGHGGIPNIILTV VTGESPPSLS

KELSSTLAGVSDVSFDSDHQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL

For any suggestions or comments, please send an email to unitrap@crg.es