Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003680 (Taf6l)
Chromosomal location
Chr 19: 8848984 - 8860753 (-)
Description
TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor Gene [Source:MGI Symbol;Acc:MGI:2444957]
RefSeq_dna
NM_146092 
RefSeq_peptide
NP_666204.1 
MGI
MGI:2444957 
Uniprot/SWISSPROT
Q8R2K4 
Human Ortholog
ENSG00000162227 (TAF6L)
Omim not available
UniTrap UNI25597
Vector Insertion
Chr 19: 8858485 - 8859611
Public Clones not available
Private Clones OST174469 (lexicon) OST156308 (lexicon) OST52273 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23260
Vector Insertion
Chr 19: 8856897 - 8857033
Public Clones not available
Private Clones OST268931 (lexicon)
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7245
Vector Insertion
Chr 19: 8850009 - 8852576
Public Clones RRT133 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36826
Vector Insertion
Chr 19: 8848983 - 8850009
Public Clones IST14305E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113244
Sequence
GTGGAAGCAGCCGTCCCTCCCCAGCAGGCGCCCTCCCAACCCCGGAGTCTGCAG CAAGTGTTAATGAGGGTATAGTATGTGCTGACCCTGCTGGAGGCC

TGGGATGCAAAG - UNI25597 - TTCCACCGGGGCCATGTCAGAACGAGAGGAGAGGAGGTTTGTGGAGATCCCTCGGGAGTCGGTCCGGCTCATGG

CAGAGAGCACAGGTCTAGAGCTGAGTGACGAGGTGGCCGCTCTGCTCGCTGAAGATGTGTGCTACCGTCTCCGAGAGGCCACACAG AATAGCTCTCAAT

TCATGAAACACACCAAACGAAGGAAGCTGACGGTGGAGGACTTCAACAGGGCTCTCAGGTGGAGCAGCGTGGAG GCTGTGTGTGGCTATGGGTCCCAGG

AGGCATTGCCCTTGCGCCCTGCAAGGGAGGGTGATCTCTACTTCCCGGAGGATCGAGAAGTGAGCCTGGTGGAGCTGGCACTAGCCACCAACATCCCCAA

GGGCTGTGCAGAGACAGCTGTCAGAG - UNI23260 - TTCATGTCTCCTATCTGGATGGCAAAGGAAACCTGGCACCTCAGGGATCAG TGCCCAGT

GCAGTGTCTTCACTGACAGATGACCTGCTCAAATACTACCAGCAAGTGACACGGGCTGTACTGGGAGATGACCCACAGCTGATGAAG GTAAAATCTGTA

AGCCACGACCTGGAACAACTGCACCGACTACTGCAGGTGGCAAGGAGCCTGATACGGAACCCACACCTGTGCTTGGGACCCTATGTCCGATCCTTGGTGG

GCAGCGTGCTTTACTGTGTCTTGGAGCCACTGGCCGCCTCCATCAACCCTTTGAATGACCACTGGACTCTGCGAGATGGGGCTGCCCTTCTACTCAGTCA

CATATTCTG GACGCATGGAGACCTTGTAAGTGGCCTGTATCAGCAGATTCTGCTGTCCCTGCAGAAGGTCCTGACAGACCCTGTTCGGCCTCTCTGTTC

TCACTATGGGGCAGTGGTGGGGCTGCATGCTCTAGGCTGGAAG - UNI7245 - GCAGTGGAGCGAGTCCTCTACCCACATCTGCCCACTTACTGGAC

AAACTTGCAGGCTGTGCTGGATGACTATTCCGTATCTAATGCCCAGGTCAAAGCGGACGGGCACAAAGTGTATGGAGCCATTCTG GTGGCCGTAGAACG

ACTATTGAAGATGAAAGCTCAGGCAGCAGAGCCCAACCGCGGTGGCCTTGGCGGGAGAGGGTACCGTCCTGCGGAGGACCTGCCTTGGGACAGCCTTCTC

CTACAAGAATCTCCCCCCGGGGGCAGCTCCGAAACAGGTTTTGGGTCTGGTCTCCCGCCACCATCAGGGGTTGCGGGACCAGAGGACCCTTCTTCCTTGA

CCCTGGCAGACATCTACCGTGAGCTATACTCCTTCTTTGGTGACAGCTTGGCCACTCGCTTTGGCACTGGCCAGCCTGCTCCCACGGCCCCGCGACCACC

CGGAGACAAGAAGGAGCCTGCGGCTGCCCCGGATTCGGTGCGGAAAATGCCGCAGCTGACTGCCAGCGCCGTGGTCAGCCCTCAGGGTGACGAAAGCCCG

TGCGGTGGGACTCTCGCCACCGCCACCGCCGCCTCGGAGAGCAGGCCGCTACCGCGCGTACACCGGGCGCGGGGTGCTCCTCGTCAGCAGGGCCCCGGCG

CGGGAACGCGAGACGTCTTCCAGAAGAGCCGCTTCGCGCCCCGTGGCGCCCCACACTTCCGGTTTATAATCGCAGGGCGTCAGGCCGGGCGGCGCTGCCG

CGGGCGCCTCTTTCAAACTGCCTTTCCTGCCCCATATGGGCCCAGCCCCGCGTCCCGCTACGTGCAGAAGCTGCCCATGATCGGCCGTACCGGCCGCCCG

GCCCGCCGCTGGGCGCTCTCCGACTACTCGCTGTACCTGCCGCTGTGAGGTTGCGGCGCCTCGGAGAATAAAGCCACACCCGG
Translation
  - UNI25597 - MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQ NSSQFMKHTKRRKLTVEDFNRALRWSSVE AVCGY

GSQEALPLRPAREGDLYFPEDREVSLVELALATNIPKGCAETAVRV - UNI23260 - VHVSYLDGKGNLAPQGSV VPSAVSSLTDDLLKYYQQVTR

AVLGDDPQLMK VKSVSHDLEQLHRLLQVARSLIRNPHLCLGPYVRSLVGSVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFW WTHGDLVSGLYQQ

ILLSLQKVLTDPVRPLCSHYGAVVGLHALGWK - UNI7245 - AVERVLYPHLPTYWTNLQAVLDDYSVSNAQVKADGHKVYGAIL VAVERLLKMKA

QAAEPNRGGLGGRGYRPAEDLPWDSLLLQESPPGGSSETGFGSGLPPPSGVAGPEDPSSLTLADIYRELYSFFGDSLATRFGTGQPAPTAPRPPGDKKEP

AAAPDSVRKMPQLTASAVVSPQGDESPCGGTLATATAASESRPLPRVHRARGAPRQQGPGAGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQT

AFPAPYGPSPASRYVQKLPMIGRTGRPARRWALSDYSLYLPL
Transcript ENSMUST00000003777
Sequence
GTGGAAGCAGCCGTCCCTCCCCAGCAGGCGCCCTCCCAACCCCGGAGTCTGCAG CAAGTGTTAATGAGGGTATAGTATGTGCTGACCCTGCTGGAGGCC

TGGGATGCAAAG - UNI25597 - TTCCACCGGGGCCATGTCAGAACGAGAGGAGAGGAGGTTTGTGGAGATCCCTCGGGAGTCGGTCCGGCTCATGG

CAGAGAGCACAGGTCTAGAGCTGAGTGACGAGGTGGCCGCTCTGCTCGCTGAAGATGTGTGCTACCGTCTCCGAGAGGCCACACAG AATAGCTCTCAAT

TCATGAAACACACCAAACGAAGGAAGCTGACGGTGGAGGACTTCAACAGGGCTCTCAGGTGGAGCAGCGTGGAG GCTGTGTGTGGCTATGGGTCCCAGG

AGGCATTGCCCTTGCGCCCTGCAAGGGAGGGTGATCTCTACTTCCCGGAGGATCGAGAAGTGAGCCTGGTGGAGCTGGCACTAGCCACCAACATCCCCAA

GGGCTGTGCAGAGACAGCTGTCAGAG - UNI23260 - TTCATGTCTCCTATCTGGATGGCAAAGGAAACCTGGCACCTCAGGGATCAG TGCCCAGT

GCAGTGTCTTCACTGACAGATGACCTGCTCAAATACTACCAGCAAGTGACACGGGCTGTACTGGGAGATGACCCACAGCTGATGAAG GTTGCCCTCCAG

GACCTCCAGACAAACTCCAAGATTGCAGCACTCCTGCCTTACTTTGTTTATGTGGTCAGTGGG GTAAAATCTGTAAGCCACGACCTGGAACAACTGCAC

CGACTACTGCAGGTGGCAAGGAGCCTGATACGGAACCCACACCTGTGCTTGGGACCCTATGTCCGATCCTTGGTGGGCAGCGTGCTTTACTGTGTCTTGG

AGCCACTGGCCGCCTCCATCAACCCTTTGAATGACCACTGGACTCTGCGAGATGGGGCTGCCCTTCTACTCAGTCACATATTCTG GACGCATGGAGACC

TTGTAAGTGGCCTGTATCAGCAGATTCTGCTGTCCCTGCAGAAGGTCCTGACAGACCCTGTTCGGCCTCTCTGTTCTCACTATGGGGCAGTGGTGGGGCT

GCATGCTCTAGGCTGGAAG - UNI7245 - GCAGTGGAGCGAGTCCTCTACCCACATCTGCCCACTTACTGGACAAACTTGCAGGCTGTGCTGGATGA

CTATTCCGTATCTAATGCCCAGGTCAAAGCGGACGGGCACAAAGTGTATGGAGCCATTCTG GTGGCCGTAGAACGACTATTGAAGATGAAAGCTCAGGC

AGCAGAGCCCAACCGCGGTGGCCTTGGCGGGAGAGGGTACCGTCCTGCGGAGGACCTGCCTTGGGACAGCCTTCTCCTACAAGAATCTCCCCCCGGGGGC

AGCTCCGAAACAGGTTTTGGGTCTGGTCTCCCGCCACCATCAGGGGTTGCGGGACCAGAGGACCCTTCTTCCTTGACCCTGGCAGACATCTACCGTGAGC

TATACTCCTTCTTTGGTGACAGCTTGGCCACTCGCTTTGGCACTGGCCAGCCTGCTCCCACGGCCCCGCGACCACCCGGAGACAAGAAGGAGCCTGCGGC

TGCCCCGGATTCGGTGCGGAAAATGCCGCAGCTGACTGCCAGCGCCGTGGTCAGCCCTCAGGGTGACGAAAGCCCGTGCGGTGGGACTCTCGCCACCGCC

ACCGCCGCCTCGGAGAGCAGGCCGCTACCGCGCGTACACCGGGCGCGGGGTGCTCCTCGTCAGCAGGGCCCCGGCGCGGGAACGCGAGACGTCTTCCAGA

AGAGCCGCTTCGCGCCCCGTGGCGCCCCACACTTCCGGTTTATAATCGCAGGGCGTCAGGCCGGGCGGCGCTGCCGCGGGCGCCTCTTTCAAACTGCCTT

TCCTGCCCCATATGGGCCCAGCCCCGCGTCCCGCTACGTGCAGAAGCTGCCCATGATCGGCCGTACCGGCCGCCCGGCCCGCCGCTGGGCGCTCTCCGAC

TACTCGCTGTACCTGCCGCTGTGAGGTTGCGGCGCCTCGGAGAATAAAGCCACACCCGG
Translation
  - UNI25597 - MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQ NSSQFMKHTKRRKLTVEDFNRALRWSSVE AVCGY

GSQEALPLRPAREGDLYFPEDREVSLVELALATNIPKGCAETAVRV - UNI23260 - VHVSYLDGKGNLAPQGSV VPSAVSSLTDDLLKYYQQVTR

AVLGDDPQLMK VALQDLQTNSKIAALLPYFVYVVSG VKSVSHDLEQLHRLLQVARSLIRNPHLCLGPYVRSLVGSVLYCVLEPLAASINPLNDHWTLR

DGAALLLSHIFW WTHGDLVSGLYQQILLSLQKVLTDPVRPLCSHYGAVVGLHALGWK - UNI7245 - AVERVLYPHLPTYWTNLQAVLDDYSVSNA

QVKADGHKVYGAIL VAVERLLKMKAQAAEPNRGGLGGRGYRPAEDLPWDSLLLQESPPGGSSETGFGSGLPPPSGVAGPEDPSSLTLADIYRELYSFFG

DSLATRFGTGQPAPTAPRPPGDKKEPAAAPDSVRKMPQLTASAVVSPQGDESPCGGTLATATAASESRPLPRVHRARGAPRQQGPGAGTRDVFQKSRFAP

RGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTGRPARRWALSDYSLYLPL

For any suggestions or comments, please send an email to unitrap@crg.es