Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003808 (Farsa)
Chromosomal location
Chr 8: 87380908 - 87393156 (+)
Description
phenylalanyl-tRNA synthetase, alpha subunit Gene [Source:MGI (curated);Acc:Farsa-001]
RefSeq_dna
NM_025648 
RefSeq_peptide
NP_079924.2 
UniGene
Mm.414759 
MGI
MGI:1913840 
Uniprot/SWISSPROT
Q8C0C7 
Uniprot/SPTREMBL
Q3U0Y9 Q4FJQ2 Q8BJG2 Q8BXN0 Q9CT72 
Human Ortholog
ENSG00000179115 (FARSA)
Omim not available
UniTrap UNI33854
Vector Insertion
Chr 8: 87381081 - 87384804
Public Clones IST10184H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5073
Vector Insertion
Chr 8: 87388259 - 87388335
Public Clones YTC563 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095222
Sequence
TGGGAGTAGCCATGGCGGATAATCCCGTTTTGGAGCTGTTGCTGCGGCGGCTGGAGGTAGCTGATGGCGGTCTGGACAGCGCGGAGTTGGCTACGCAGCT

GGGTGTGGAGCACCAGGCGGTGGTGGGCGCAGTGAAGAGCCTTCAAGCTCTGGGTGAG - UNI33854 - GTCATTGAGGCTGAGCTTCGTTCTACCA

AGTGCTGGGAGCTGACTACTGAGGGTGAGGAGATTGCCCGGGAGGGCAGCCATGAGGCCCGTGTGTTTAGAAGCATCCCTCTCGAGGGCCTGGTGCAGAG

TGAGCTCATG CACCTGCCCAGCGGCAAGGTGGGCTTCAGCAAGGCCATGTCCAACAAGTGGATCCGAGTGGACAAGAGTGCCGCCGACGGGCCCCGGGT

GTTCCGAGTG GTGGACAGTATAGAGGATGAAGTGCAGAAGCGGTTGCAGCTGGTCCAGGCAGGCCAGGCTGAGAAGCTGGCTGAAAAGGAACGGAATGA

GCTCAGGAAGAGGAAGCTGCTGACGGAAGT GATCCTGAAAACCTACTGGGTGAGCAAGGGCAAGGCCTTCAGCACAAGCGTGTCTAAGCAGGAGGCAGA

GCTGAGCCCAGAGATGATCTCCAG TGGCTCTTGGAGGGACCGACCTTTCAAACCCTACAACTTCTCTGCCCGTGGTGTGCTCCCAGATAGTGGCCACCT

GCACCCCTTGCTCAAGGTCCGCTCTCAGTTCCGACAAATCTTCTTGGAGATGGG - UNI5073 - GTTCACTGAGATGCCTACGGACAATTTCATTGA

GAGCTCCTTCTGGAACTTTGATGCACTCTTTCAGCCTCAGCAGCACCCAGCACGTGACCAACATGATACTTTCTTCCTGCGAGGTTGGTAGCCCGGGAGC

CTGGCCAATGTGGTAGCAGAAGTCTCAAGTCTGGATAAAGCTTTAGGGAAGGGATATATCGTATTTTATAAACTGAGATCTGACCTCCCTGTGGCCAGCT

GGTCCCGTCCTCCACTGTGATCTCTCCCCACAGTGCCTAGGCTCTGCTTTCTGAACTTGCCAGACCTGCCCTGGGGGCTCTGTCAGTTTAGGCCAATCAC

TCAGAGTTCTTTTGTTTTGTTTTTATAGAGAAAAAGGGTTTTGCTATGTGGCCTTGACTAGTCTAGAGCTCATGTAGACATGGCTCTCACAAGGATTTCC

CTGCCCTACTAAGGCTAGGCTTAAAGGTATATGTCACAATGCATTTTTATTTCATTTTATTCAGAATTCTACTGGCTGCCCTGAAACTCATTATGTAGAC

CAGGCTGGCCTCAGACTCACAAAGATCCACTGTCTTCTGCCTCCCTAGTGTTTGTACTATAGGCATGGGCCACCATGCCTAGCATGTCCCAGGGTTGTAC

TACAGGCATGGGCCACCATGCCTAGCATGTCCCAGGGTTGTACTACAGGCATGGGCCACCACGCCAGCATTTCCCAGGGTTTTGTTTTGTTTTTTTTTTT

CCCCCTGGGGACAGGGTTTCTTGGTAGCCGTGGCTGTCCTGAAACTCCCTGTAGACAAGGCTGACCTGAAAATTAGAGATTCACCCGCTTCTGTCTCTGC

CTCCTGAGTGCTGGGATAAAAGGCATGCATCATCACTGCCTGGCCTCATGTCCAAGATTTTTAATGCCACCTAAGGGCTAGAGTGTGGCATATTGGAACC

TGGATTTTATCTGTCCTTAGCATAAATAGGTAATCAAACTCCACCCTGGCTCTGTCCTTTCCCCCTCACTATCATGTAAGCCCTCCAGTGTTTACTTGAG

GCCAGAATCCTTTTCACTAAACTGAAGCACATATGTGGCCTAGTTGAGTTCCCAGCACCATATTTGATGCTCACAACAGCCTTTAACTCCAGCTCCAAGG

AATCTGCCATCTGGGCTAAGGCACACAAGCTCATGTGCATTACAACCAACCACACACAGATAAGGTATACACACAATTGAAAAATAAAAAAGACCCATTA

AATAGAAGCTTATTTTTCTTGGTTCTGGACATGCACATCACTCCACTTTTAACTTGGTTGTTTTTTGTTTTTTCAGCTAGAGTCCCCCACTGTAGCCCAG

GCTGGCCTTGAACTCATGTCCTCCTGCCTCTGCTTTTGAAGTGCTAATCTTCCCTCATTATTTTGAGTTGTTTTAAGACAGGGTCCCACTCTGTAGCTGG

CCTACAAGTTACTATGTAGCCACAATGTGGAATCCAGGATTTCCTGCATGTTGGCAAGTTTTCTGTCCCCAAGTTCTCTGTCCCTTGTCACAGGCCATTC

CCTATTTCACTGTCCTTGATCTCTCTGAAATGAATGGCTTCTCAGACTGGTTGTCTTCTCGCCTCTGAAGCGAGCAGATGAGCTTCCTAAGTACCCGTGC

CAATGTAGCAGCAATGGTGTTGCTGTTGTCATGGTACCCAAAGCTCACCTTCTGCTCCGTTGTTCTGAACCTTCCAACCATACACTGTGGTACTGTTGGC

CCTCATTTACCACTGAGGAAACTGAGGCACAGAAAGAACATCATTTGCCTAATGCTATACAGCTGTTACATGCAAAAGACTTACAGGAACCAAAACTATG

TTGTTACCATTCCCAAAAAGTTCACATTTGAGGTGGATATGGTTGGTGGCTCTTTCCTGTCAGGACTACTCAGGAGGCTGAGGGGAAAATTGTAAGTTCC

TAAAAAAAAAAAAGAACTGTTTTGCTCATTTGCTTCTGGGGGTGCATGTTAGTGGATTAACACTTGCTAAACCTGAGGAAGGCCCTGGGTTCCAGGAAAC

ATTGGGGAAAAGTCACATACTTCGAGGCCTCCCTGAAGATCCTCCTGAATGCTAAGATGGCTGTTACCAACTGAGTCATAGCTTTGAGTAGGACAGAATT

CCCTCACCCCAGGGAGATCCATTTCCTGACTAGATAGTTCCTGAAGAATCTATATAGTGGGACAAGGGGTTAAAAATCACTGGAGATAGCCGGGCAGTGG

TGGCGCACACCTTTAATCCCAGCATTTGGGAGGCAGAGGCAGGAGGATTTCTAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGAACAGCCAGGG

CTACACAGAGAAACCCTGTCTTGAAAAACTAAACAAACAAACAAACAAACAAACAAAAAAAACAAAACCACTGGAGATACTAATGTGTGCCTCTAGGGCT

AGGGGAGGTTGGAAGCACGTGTTGCTTGAGTCTTAAACAAGGTTGGGTTGTGGTAGCATATACCTTTTATCACAGCATTTGGGAGGCAGAGGCAGATGGC

TCTCTAAGTTCAAGGCCAGTCTGGTTTGCATAGTGAGCTACAGTCAGATCAAGTATC
Translation
MADNPVLELLLRRLEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGE - UNI33854 - VIEAELRSTKCWELTTEGEEIAREGSHEARVFRSIPL

EGLVQSELM HLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRV VDSIEDEVQKRLQLVQAGQAEKLAEKERNELRKRKLLTEV VILKTYWVSKGKAFS

TSVSKQEAELSPEMISS SGSWRDRPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLEMG - UNI5073 - GFTEMPTDNFIESSFWNFDALFQPQ

QHPARDQHDTFFLRGW
Transcript ENSMUST00000109754
Sequence
AGCACGCTGGGAGTAGCCATGGCGGATAATCCCGTTTTGGAGCTGTTGCTGCGGCGGCTGGAGGTAGCTGATGGCGGTCTGGACAGCGCGGAGTTGGCTA

CGCAGCTGGGTGTGGAGCACCAGGCGGTGGTGGGCGCAGTGAAGAGCCTTCAAGCTCTGGGTGAG - UNI33854 - GTCATTGAGGCTGAGCTTCGT

TCTACCAAGTGCTGGGAGCTGACTACTGAGGGTGAGGAGATTGCCCGGGAGGGCAGCCATGAGGCCCGTGTGTTTAGAAGCATCCCTCTCGAGGGCCTGG

TGCAGAGTGAGCTCATG CACCTGCCCAGCGGCAAGGTGGGCTTCAGCAAGGCCATGTCCAACAAGTGGATCCGAGTGGACAAGAGTGCCGCCGACGGGC

CCCGGGTGTTCCGAGTG GTGGACAGTATAGAGGATGAAGTGCAGAAGCGGTTGCAGCTGGTCCAGGCAGGCCAGGCTGAGAAGCTGGCTGAAAAGGAAC

GGAATGAGCTCAGGAAGAGGAAGCTGCTGACGGAAGT GATCCTGAAAACCTACTGGGTGAGCAAGGGCAAGGCCTTCAGCACAAGCGTGTCTAAGCAGG

AGGCAGAGCTGAGCCCAGAGATGATCTCCAG TGGCTCTTGGAGGGACCGACCTTTCAAACCCTACAACTTCTCTGCCCGTGGTGTGCTCCCAGATAGTG

GCCACCTGCACCCCTTGCTCAAGGTCCGCTCTCAGTTCCGACAAATCTTCTTGGAGATGGG - UNI5073 - GTTCACTGAGATGCCTACGGACAATT

TCATTGAGAGCTCCTTCTGGAACTTTGATGCACTCTTTCAGCCTCAGCAGCACCCAGCACGTGACCAACATGATACTTTCTTCCTGCGAG ACCCAGCTG

AGGCCCTGCAGCTTCCAATGGGCTATGTCCAGCGCGTGAAACGGACCCACTCCCAGGGTGGCTACGGCTCACAGGG CTACAAGTATACCTGGAAGCTGG

AAGAGGCCCGGAAAAACCTGCTTCGCACACACACCACAGCAGCCAGCGCCCGCGCCCTCTACCAGTTAGCCCAGAAG CCGTTTACACCAGCCAAGTACT

TCTCTATTGATCGTGTGTTTCGGAATGAGACGCTGGACGCCACGCACCTGGCGGAGTTCCACCAGATTGAGGGTGTAATAGCAGACCATGGTCTCACCCT

AGGCCACCTCATGGGTGTGCTGAGGGAGTTCTTCACCAAGCTGG GAATCACGCAGTTGCGCTTCAAACCAGCCTACAACCCCTACACAGAGCCCAGCAT

GGAAGTGTTCAGCTACCACCAAG GTCTAAAGAAGTGGGTTGAAGTTGGCAACTCTGGGGTCTTCCGCCCTGAGATGCTCCTGCCTATGGGGCTCCCTGA

GAATGTGTCTGTCATTGCTTGGGGTCTCTCCCTGGAACG CCCAACAATGATCAAATATGGCATCAATAACATCCGAGAACTGGTGGGCCACAAGGTGAA

CCTGCAGATGGTATACGACAGCCCTGTGTGCCGACTGGATATTGAGCCCAGGTCCTCAAAGACACAGGAGGCTGCATGATATAGGCTGTTCCAGAGATCC

CTGTCTAGTCCCTGTGCATCTCTTGGCAGTGACCTACTATTTATGAGGCCTCTGTGAGGCCAGCTCACTCCCCCTGCCTCTCCCACCCTGGGGGCAGGGT

TCTAAGTATGGGGAGTTCTTATGCTGGCTTTTAGTGGTGTGTGTAGTTTGCTTGTAAGGGTGGGTTTGGCCCTGCAGGCCAGCTGTTTTAATAAAGTGGG

CACATTCCCTCATTTGGTGCCTTTTGTTAGGA
Translation
MADNPVLELLLRRLEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGE - UNI33854 - VIEAELRSTKCWELTTEGEEIAREGSHEARVFRSIPL

EGLVQSELM HLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRV VDSIEDEVQKRLQLVQAGQAEKLAEKERNELRKRKLLTEV VILKTYWVSKGKAFS

TSVSKQEAELSPEMISS SGSWRDRPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLEMG - UNI5073 - GFTEMPTDNFIESSFWNFDALFQPQ

QHPARDQHDTFFLRD DPAEALQLPMGYVQRVKRTHSQGGYGSQG GYKYTWKLEEARKNLLRTHTTAASARALYQLAQK PFTPAKYFSIDRVFRNETL

DATHLAEFHQIEGVIADHGLTLGHLMGVLREFFTKLG GITQLRFKPAYNPYTEPSMEVFSYHQG GLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAWG

LSLER RPTMIKYGINNIRELVGHKVNLQMVYDSPVCRLDIEPRSSKTQEAA
Transcript ENSMUST00000003906
Sequence
ACACGCCAAGCACGCTGGGAGTAGCCATGGCGGATAATCCCGTTTTGGAGCTGTTGCTGCGGCGGCTGGAGGTAGCTGATGGCGGTCTGGACAGCGCGGA

GTTGGCTACGCAGCTGGGTGTGGAGCACCAGGCGGTGGTGGGCGCAGTGAAGAGCCTTCAAGCTCTGGGTGAG - UNI33854 - GTCATTGAGGCTG

AGCTTCGTTCTACCAAGTGCTGGGAGCTGACTACTGAGGGTGAGGAGATTGCCCGGGAGGGCAGCCATGAGGCCCGTGTGTTTAGAAGCATCCCTCTCGA

GGGCCTGGTGCAGAGTGAGCTCATG CACCTGCCCAGCGGCAAGGTGGGCTTCAGCAAGGCCATGTCCAACAAGTGGATCCGAGTGGACAAGAGTGCCGC

CGACGGGCCCCGGGTGTTCCGAGTG GTGGACAGTATAGAGGATGAAGTGCAGAAGCGGTTGCAGCTGGTCCAGGCAGGCCAGGCTGAGAAGCTGGCTGA

AAAGGAACGGAATGAGCTCAGGAAGAGGAAGCTGCTGACGGAAGT GATCCTGAAAACCTACTGGGTGAGCAAGGGCAAGGCCTTCAGCACAAGCGTGTC

TAAGCAGGAGGCAGAGCTGAGCCCAGAGATGATCTCCAG TGGCTCTTGGAGGGACCGACCTTTCAAACCCTACAACTTCTCTGCCCGTGGTGTGCTCCC

AGATAGTGGCCACCTGCACCCCTTGCTCAAGGTCCGCTCTCAGTTCCGACAAATCTTCTTGGAGATGGG - UNI5073 - GTTCACTGAGATGCCTAC

GGACAATTTCATTGAGAGCTCCTTCTGGAACTTTGATGCACTCTTTCAGCCTCAGCAGCACCCAGCACGTGACCAACATGATACTTTCTTCCTGCGAG A

CCCAGCTGAGGCCCTGCAGCTTCCAATGGGCTATGTCCAGCGCGTGAAACGGACCCACTCCCAGGGTGGCTACGGCTCACAGGG CTACAAGTATACCTG

GAAGCTGGAAGAGGCCCGGAAAAACCTGCTTCGCACACACACCACAGCAGCCAGCGCCCGCGCCCTCTACCAGTTAGCCCAGAAG AAGCCGTTTACACC

AGCCAAGTACTTCTCTATTGATCGTGTGTTTCGGAATGAGACGCTGGACGCCACGCACCTGGCGGAGTTCCACCAGATTGAGGGTGTAATAGCAGACCAT

GGTCTCACCCTAGGCCACCTCATGGGTGTGCTGAGGGAGTTCTTCACCAAGCTGG GAATCACGCAGTTGCGCTTCAAACCAGCCTACAACCCCTACACA

GAGCCCAGCATGGAAGTGTTCAGCTACCACCAAG GTCTAAAGAAGTGGGTTGAAGTTGGCAACTCTGGGGTCTTCCGCCCTGAGATGCTCCTGCCTATG

GGGCTCCCTGAGAATGTGTCTGTCATTGCTTGGGGTCTCTCCCTGGAACG CCCAACAATGATCAAATATGGCATCAATAACATCCGAGAACTGGTGGGC

CACAAGGTGAACCTGCAGATGGTATACGACAGCCCTGTGTGCCGACTGGATATTGAGCCCAGGTCCTCAAAGACACAGGAGGCTGCATGATATAGGCTGT

TCCAGAGATCCCTGTCTAGTCCCTGTGCATCTCTTGGCAGTGACCTACTATTTATGAGGCCTCTGTGAGGCCAGCTCACTCCCCCTGCCTCTCCCACCCT

GGGGGCAGGGTTCTAAGTATGGGGAGTTCTTATGCTGGCTTTTAGTGGTGTGTGTAGTTTGCTTGTAAGGGTGGGTTTGGCCCTGCAGGCCAGCTGTTTT

AATAAAGTGGGCACATTCCCTCATTTGGTGCCTTTTGTTAGG
Translation
MADNPVLELLLRRLEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGE - UNI33854 - VIEAELRSTKCWELTTEGEEIAREGSHEARVFRSIPL

EGLVQSELM HLPSGKVGFSKAMSNKWIRVDKSAADGPRVFRV VDSIEDEVQKRLQLVQAGQAEKLAEKERNELRKRKLLTEV VILKTYWVSKGKAFS

TSVSKQEAELSPEMISS SGSWRDRPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLEMG - UNI5073 - GFTEMPTDNFIESSFWNFDALFQPQ

QHPARDQHDTFFLRD DPAEALQLPMGYVQRVKRTHSQGGYGSQG GYKYTWKLEEARKNLLRTHTTAASARALYQLAQK KPFTPAKYFSIDRVFRNET

LDATHLAEFHQIEGVIADHGLTLGHLMGVLREFFTKLG GITQLRFKPAYNPYTEPSMEVFSYHQG GLKKWVEVGNSGVFRPEMLLPMGLPENVSVIAW

GLSLER RPTMIKYGINNIRELVGHKVNLQMVYDSPVCRLDIEPRSSKTQEAA

For any suggestions or comments, please send an email to unitrap@crg.es