Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003813 (Rad23a)
Chromosomal location
Chr 8: 87358551 - 87364540 (-)
Description
RAD23a homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Rad23a-001]
RefSeq_dna
NM_009010 
RefSeq_peptide
NP_033036.2 
MGI
MGI:105126 
Uniprot/SWISSPROT
P54726 
Uniprot/SPTREMBL
Q8BRA9 Q8CAP3 Q05DT7 Q3TN85 
Human Ortholog
ENSG00000179262 (RAD23A)
Omim not available
UniTrap UNI24674
Vector Insertion
Chr 8: 87362855 - 87364392
Public Clones not available
Private Clones OST210343 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4047
Vector Insertion
Chr 8: 87359574 - 87359653
Public Clones AQ0327 (sanger) AQ0315 (sanger)
Private Clones OST45263 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109761
Sequence
GGGCGCTAAGATGGCGGCGGCGTGAGTTGCATGTAGTACGAGGATCCCGGGGCTGCCGCATTGCTCCGGCCCCGCCATGGCCGTCACCATCACCCTTAAA

ACGTTGCAGCAGCAGACCTTCAAGATCCGCATGGAACCTGACGAGACG - UNI24674 - GTAAAGGTGCTGAAGGAGAAGATAGAAGCTGAGAAGGG

TAGAGATGCTTTCCCCGTGGCTGGACAGAAACTCATCTATGCTGGCAAGATCTTGAGTGACGATGTTCCCATCAAGGAATACCATATAGATGAGAAGAAC

TTTGTGGTTGTCATGGTGACCAAG GCCAAAGCTGGCCAGGGTATCCCGGCACCCCCAGAGGCCTCACCCACTGCTGTCCCGGAGCCCTCCACACCTTTC

CCTCCAGTCCTGGCATCAGGCATGTCTCATCCCCCACCTACCAGCAGAGAGGACAAGAGCCCATCAGAGGAGTCAACCACCACAACATCTCCAGAATCCA

TTTCTGG CTCTGTTCCCTCTTCAGGTAGCAGCGGGCGAGAGGAAGACGCAGCTTCCACATTAG TGACTGGCTCTGAATATGAGACGATGCTGACTGAG

ATCATGTCCATGGGCTACGAGCGGGAGCGGGTTGTGGCCGCATTGAGGGCCAGCTACAACAACCCCCACCGAGCTGTGGAGTACTTGCTCACG GGAATT

CCAGGAAGCCCTGAGCCTGAACATGGTTCTGTCCAGGAAAGCCAGGCGCCTGAGCAGCCGGCCACAGAAGCAG GGGAGAACCCCCTGGAGTTCCTGCGG

GACCAGCCTCAGTTCCAGAACATGCGGCAAGTGATTCAACAGAACCCAGCGCTCCTGCCTGCTCTGCTCCAGCAGCTGGGTCAGGAAAACCCTCAGCTCC

TGCAG CAAATTAGCCGTCACCAGGAGCAGTTCATCCAGATGTTGAATGAGCCTCCCGGGGAGCTGGCGGACATCTCTGATGTAGAGGGGGAGGTTGGTG

CCATAGGTGAGGAGGCCCCACAGATGAACTATATCCAGGTGACACCGCAGGAGAAGGAGGCTATAGAAAGG - UNI4047 - CTGAAGGCACTGGGCT

TCCCAGAGAGCCTGGTGATCCAGGCCTACTTCGCGTGTGAAAAAAATGAGAATTTGGCTGCCAACTTCCTCCTGAGTCAGAACTTTGATGATGAGTGATT

CTGGGAGGCCAGGGCCTCCCCCCTTCCCTCCCTCCCCACTCCACAGACGTTTATAAGAGAAAGTATATATATATATATATAACATATATATATTCATGTT

TAAGAGGAAGAATATCAAAAACCATTAAAAAAACAACAACAAAAAAAAACCCAGCCCAGCTTCCCACCCTCCTGAAGTGGCCCCCATTCCCATATCAGTC

CGAGAAGACCTGGGCCAGACAGCTGTCCCCGTCCTCTTAACAGCCCAGCCTACTCAAAAGTTGTTGGCAAGACCATGAGGCGACAGATGGGCCCCTCTTG

GCCTCTGTCCCAGCTCCCTGCAGCCAGATGGAGGGGCGCCTGCCTGCTTCCCCATCCCTGAAGCATCCCCAAGGACAACCCTCCTTCCTCCACCATGATG

AGGGGAAGCTGGAGCCCTAAGCTTTGATCCTCTATTGGAGTGGCCCAGATCTTTCCATCTGGAGTAAGTCTATGTTAGAAGCCAAAGGCCTTCTCCCCAG

TCTGGCCTTGGCCTCCAGCCTGGAAAAGGGGTTATCATCAGTTCTGAAGGCCAAGGCCACCCCTTCCCCAGGACAGAACCACATCTCTGATAAAGGTTTT

GACGTGAATAAAGTTTTAAAAATGAGCCCTAATAATGGTTCATGCCTACTGGAGCTTCTCACAGCTGTTTGTGAGTCTGAGCTAGCCGGGGGCACAGGTG

AAGTGGGCATGCTGAGAAACGGGGAGGAGCCTAGGAGCCTTACAGACGGGCCCCAGCATCTCCTCCCTCTGGAAACTTGGGCCCCTGCCTCAGCTCAACC

CTAGAAGGACTGCTGCTCCTTCTATCATGCAGTCTGTTTGGCTGTACTCCCCCTGGTAATTGGCTAATTACTGGAGATTAATGTTGGTAAACAGAAGCCT

CCTCCTC
Translation
MAVTITLKTLQQQTFKIRMEPDET - UNI24674 - VKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIKEYHIDEKNFVVVMVTK AKAGQGI

PAPPEASPTAVPEPSTPFPPVLASGMSHPPPTSREDKSPSEESTTTTSPESISG GSVPSSGSSGREEDAASTLV VTGSEYETMLTEIMSMGYERERVV

AALRASYNNPHRAVEYLLT GIPGSPEPEHGSVQESQAPEQPATEAG GENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQ QISRHQE

QFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIER - UNI4047 - LKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE
Transcript ENSMUST00000003911
Sequence
GGGCGCTAAGATGGCGGCGGCGTGAGTTGCATGTAGTACGAGGATCCCGGGGCTGCCGCATTGCTCCGGCCCCGCCATGGCCGTCACCATCACCCTTAAA

ACGTTGCAGCAGCAGACCTTCAAGATCCGCATGGAACCTGACGAGACG - UNI24674 - GTAAAGGTGCTGAAGGAGAAGATAGAAGCTGAGAAGGG

TAGAGATGCTTTCCCCGTGGCTGGACAGAAACTCATCTATGCTGGCAAGATCTTGAGTGACGATGTTCCCATCAAGGAATACCATATAGATGAGAAGAAC

TTTGTGGTTGTCATGGTGACCAAG GCCAAAGCTGGCCAGGGTATCCCGGCACCCCCAGAGGCCTCACCCACTGCTGTCCCGGAGCCCTCCACACCTTTC

CCTCCAGTCCTGGCATCAGGCATGTCTCATCCCCCACCTACCAGCAGAGAGGACAAGAGCCCATCAGAGGAGTCAACCACCACAACATCTCCAGAATCCA

TTTCTGG CTCTGTTCCCTCTTCAGGTAGCAGCGGGCGAGAGGAAGACGCAGCTTCCACATTAG TGACTGGCTCTGAATATGAGACGATGCTGACTGAG

ATCATGTCCATGGGCTACGAGCGGGAGCGGGTTGTGGCCGCATTGAGGGCCAGCTACAACAACCCCCACCGAGCTGTGGAGTACTTGCTCACG GGAATT

CCAGGAAGCCCTGAGCCTGAACATGGTTCTGTCCAGGAAAGCCAGGCGCCTGAGCAGCCGGCCACAGAAGCAG CAGGGGAGAACCCCCTGGAGTTCCTG

CGGGACCAGCCTCAGTTCCAGAACATGCGGCAAGTGATTCAACAGAACCCAGCGCTCCTGCCTGCTCTGCTCCAGCAGCTGGGTCAGGAAAACCCTCAGC

TCCTGCAG CAAATTAGCCGTCACCAGGAGCAGTTCATCCAGATGTTGAATGAGCCTCCCGGGGAGCTGGCGGACATCTCTGATGTAGAGGGGGAGGTTG

GTGCCATAGGTGAGGAGGCCCCACAGATGAACTATATCCAGGTGACACCGCAGGAGAAGGAGGCTATAGAAAGG - UNI4047 - CTGAAGGCACTGG

GCTTCCCAGAGAGCCTGGTGATCCAGGCCTACTTCGCGTGTGAAAAAAATGAGAATTTGGCTGCCAACTTCCTCCTGAGTCAGAACTTTGATGATGAGTG

ATTCTGGGAGGCCAGGGCCTCCCCCCTTCCCTCCCTCCCCACTCCACAGACGTTTATAAGAGAAAGTATATATATATATATATAACATATATATATTCAT

GTTTAAGAGGAAGAATATCAAAAACCATTAAAAAAACAACAACAAAAAAAAACCCAGCCCAGCTTCCCACCCTCCTGAAGTGGCCCCCATTCCCATATCA

GTCCGAGAAGACCTGGGCCAGACAGCTGTCCCCGTCCTCTTAACAGCCCAGCCTACTCAAAAGTTGTTGGCAAGACCATGAGGCGACAGATGGGCCCCTC

TTGGCCTCTGTCCCAGCTCCCTGCAGCCAGATGGAGGGGCGCCTGCCTGCTTCCCCATCCCTGAAGCATCCCCAAGGACAACCCTCCTTCCTCCACCATG

ATGAGGGGAAGCTGGAGCCCTAAGCTTTGATCCTCTATTGGAGTGGCCCAGATCTTTCCATCTGGAGTAAGTCTATGTTAGAAGCCAAAGGCCTTCTCCC

CAGTCTGGCCTTGGCCTCCAGCCTGGAAAAGGGGTTATCATCAGTTCTGAAGGCCAAGGCCACCCCTTCCCCAGGACAGAACCACATCTCTGATAAAGGT

TTTGACGTGAATAAAGTTTTAAAAATGAGCCCTAATAATGGTTCATGCCTACTGGAGCTTCTCACAGCTGTTTGTGAGTCTGAGCTAGCCGGGGGCACAG

GTGAAGTGGGCATGCTGAGAAACGGGGAGGAGCCTAGGAGCCTTACAGACGGGCCCCAGCATCTCCTCCCTCTGGAAACTTGGGCCCCTGCCTCAGCTCA

ACCCTAGAAGGACTGCTGCTCCTTCTATCATGCAGTCTGTTTGGCTGTACTCCCCCTGGTAATTGGCTAATTACTGGAGATTAATGTTGGTAAACAGAAG

CCTCCTCCTC
Translation
MAVTITLKTLQQQTFKIRMEPDET - UNI24674 - VKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIKEYHIDEKNFVVVMVTK AKAGQGI

PAPPEASPTAVPEPSTPFPPVLASGMSHPPPTSREDKSPSEESTTTTSPESISG GSVPSSGSSGREEDAASTLV VTGSEYETMLTEIMSMGYERERVV

AALRASYNNPHRAVEYLLT GIPGSPEPEHGSVQESQAPEQPATEAA AGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQ QISRHQ

EQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYIQVTPQEKEAIER - UNI4047 - LKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE

For any suggestions or comments, please send an email to unitrap@crg.es