Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000003868 (Ruvbl2)
Chromosomal location
Chr 7: 52677222 - 52693466 (-)
Description
RuvB-like protein 2 Gene [Source:MGI (curated);Acc:Ruvbl2-001]
RefSeq_dna
NM_011304 
RefSeq_peptide
NP_035434.1 
UniGene
Mm.34410 
MGI
MGI:1342299 
Uniprot/SWISSPROT
Q9WTM5 
Uniprot/SPTREMBL
Q3TXT7 Q3UXP2 
Human Ortholog
ENSG00000183207 (RUVBL2)
Omim not available
UniTrap UNI13274
Vector Insertion
Chr 7: 52686745 - 52689621
Public Clones CMHD-GT_340H1-3 (cmhd) PST22049-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14841
Vector Insertion
Chr 7: 52685278 - 52686745
Public Clones PST10826-NL (escells) PST6269-NR (escells) PST6269-NL (escells)
Private Clones OST250741 (lexicon) OST171286 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23950
Vector Insertion
Chr 7: 52684966 - 52685278
Public Clones not available
Private Clones OST239689 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29968
Vector Insertion
Chr 7: 52684022 - 52684966
Public Clones D174H06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20287
Vector Insertion
Chr 7: 52679748 - 52680051
Public Clones not available
Private Clones OST368248 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033087
Sequence
GGAGAGGCAAAGGGAGGCTCAGAAGACCTGGCCCGCATTCCTCGCCGGCTTACATCCCCAGCCTG CACAGTGTAGATGCCACCCACTGTGGGCCAAAGT

GCAAAAGGACAGACAACCCCACCATTGGTCCATAGCTTTGAGACCTGGCAG GGCCTAGGACGCCTACTCCAGCCCCTTCACAAGGACACAGAAGTCACA

GGCGCTTTTCCCAGGACCCAAGACTCCTCCACGTAACTCTTTTCCCGTCTGAAACGGAGTTTCGGGGCCCCATCCTCGCCTGCCCTTCTTGGTCAAGGGA

CCAACGCTGACGTTCTCACCCTTGTTGGCCACCTCCCAGGCCACCTCGAAAAGCACTGCGTTCTCGGGGTCGAATTCATCCTCCCAGTCTTCCAATCCTG

GAAGCGAGGACACAGAGAGACTGCGGCTGAGAGGCATGGCTACTGCGGGCAGGGGACTTCGAGCACCAAAACTGGAAACCAGAGAGATCGGCTGGGAACG

CAGCAGACTTGGTGACCGGTAGAGTTAGCGGGTGTCCCAGGGGAAGCTTGCAAGGCGCTCCGCTTCCTATTGCACGACCGCACCCCCGCCCCAGAGCGCT

CCGACTCAG AGATGACTGGATGACCGGGAGCCTAGAGAGGATAAAGACCGCGCTCCTAGCCGATTTCCGTTTCCGCTGAGGCATTGGCGGTTGGTGTGC

ATCATGGCAACCGTG - UNI13274 - - UNI14841 - GCAGCCACCACCAAAGTCCCTGAGATCCGAGATGTGACAAGAATCGAGCGAATCG - 

UNI14841 - GCGCTCACTCCCACATCCGGGGGCTGGGACTGGATGATGCCCTGGAGCCAAGACAG - UNI14841 - - UNI23950 - - UNI2

9968 - GCTTCCCAGGGAATGGTGGGGCAGCTAGCTGCCCGGCGTGCAGCTGGCGTGGTGCTGGAGATGATCCGAGAAGGGAAGATTGCAGGGCGGGCC

GTCCTCATTGCAGGCCAGCCAGGCACTGGGAAGACAGCCATTGCCATGG - UNI29968 - GCATGGCCCAGGCACTGGGCCCCGACACACCATTCAC

AGCCATCGCAGGCAGTGAGATCTTTTCTCTGGAGATGAGCAAGACTGAGGCTCTAACGCAAGCCTTCCGCCGTTCCATTGGTGTCCGGATCAA - UNI2

9968 - GGAGGAGACAGAGATCATTGAAGGGGAGGTGGTAGAGATCCAGATTGACCGGCCAGCCACAGGCACG GGATCCAAGGTGGGCAAACTGACCC

TCAAGACCACGGAGATGGAGACCATCTACGACCTGGGTACCAAGATGATCGAGTCCCTGACCAAGGACAAGGTCCAGGCCGG AGACGTCATCACCATTG

ACAAGGCCACCGGCAAGATCTCCAAGCTGGGCCGCTCTTTCACACGTGCACGGGACTACGACGCCATGGGCTCCCAG ACCAAGTTTGTGCAGTGCCCAG

ACGGAGAGCTGCAGAAACGCAAGGAGGTGGTGCACACCGTGTCCCTCCATGAGATTGACGTCATCAACTCCCGTACTCAGGGCTTCCTGGCCCTCTTCTC

AG - UNI20287 - GAGACACAGGGGAGATCAAGTCAGAAGTCCGAGAACAGATCAATGCAAAGGTGGCTGAGTGGAGAGAGGAGGGCAAGGCAGAGA

TCATTCCTGGG GTGCTGTTCATCGACGAGGTCCACATGCTGGACATTGAGAGTTTCTCTTTCCTCAACCGGGCCCTGGAGAGCGACATGGCGCCTGTCC

TCATCATGGCCACCAACCGAGGGATCACCCG GATCCGAGGCACCAGCTACCAGAGTCCCCACGGCATCCCCATCGACCTGCTGGACCGCTTGCTCATTG

TATCAACGTCACCCTACAGTGAGAAGGATACCAAGCAGATTCTGCGCATCCG CTGTGAGGAGGAAGATGTGGAGATGAGTGAGGACGCCTACACAGTGC

TGACCCGCATTGGGCTCGAGACCTCCCTGCGCTATGCCATCCAGCTCATCACAGCGGCCAGCCTGGTGTGCCGGAAACGAAAG GGCACCGAGGTGCAGG

TCGATGACATTAAGCGTGTATACTCCCTCTTCCTGGATGAATCCCGCTCCACACAGTACATGAAGGAGTACCAAGATGCCTTCCTCTTCAATGAGCTCA 

AAGGCGAAACAATGGACACCTCCTGAGCTGACCTGACACCCCAGCCCTTCCCACCCCATTTTCTACAAGTTCTAACACTGTGACTTTATATAAAATTATT

GAAAACTGGACCTCTGCTGTGTCCTCAGAGCCTACTAAAGAACATGGAAGCGCA
Translation
   MATV - UNI13274 - - UNI14841 - AATTKVPEIRDVTRIERIG - UNI14841 - GAHSHIRGLGLDDALEPRQ - UNI14841 - 

- UNI23950 - - UNI29968 - ASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMG - UNI29968 - GMAQALGPDTPF

TAIAGSEIFSLEMSKTEALTQAFRRSIGVRIK - UNI29968 - KEETEIIEGEVVEIQIDRPATGT GSKVGKLTLKTTEMETIYDLGTKMIESLTK

DKVQAG GDVITIDKATGKISKLGRSFTRARDYDAMGSQ TKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSG - UNI20287 - GDTG

EIKSEVREQINAKVAEWREEGKAEIIPG VLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITR RIRGTSYQSPHGIPIDLLDRLLIVSTSPYS

EKDTKQILRIR RCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRK GTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK KGE

TMDTS
Transcript ENSMUST00000107771
Sequence
GCATTGGCGGTTGGTGTGCATCATGGCAACCGTG - UNI13274 - - UNI14841 - GCAGCCACCACCAAAGTCCCTGAGATCCGAGATGTGACA

AGAATCGAGCGAATCG - UNI14841 - GCGCTCACTCCCACATCCGGGGGCTGGGACTGGATGATGCCCTGGAGCCAAGACAG - UNI14841 - 

- UNI23950 - - UNI29968 - GCTTCCCAGGGAATGGTGGGGCAGCTAGCTGCCCGGCGTGCAGCTGGCGTGGTGCTGGAGATGATCCGAGAAGG

GAAGATTGCAGGGCGGGCCGTCCTCATTGCAGGCCAGCCAGGCACTGGGAAGACAGCCATTGCCATGG - UNI29968 - GCATGGCCCAGGCACTGG

GCCCCGACACACCATTCACAGCCATCGCAGGCAGTGAGATCTTTTCTCTGGAGATGAGCAAGACTGAGGCTCTAACGCAAGCCTTCCGCCGTTCCATTGG

TGTCCGGATCAA - UNI29968 - GGAGGAGACAGAGATCATTGAAGGGGAGGTGGTAGAGATCCAGATTGACCGGCCAGCCACAGGCACG GGATCC

AAGGTGGGCAAACTGACCCTCAAGACCACGGAGATGGAGACCATCTACGACCTGGGTACCAAGATGATCGAGTCCCTGACCAAGGACAAGGTCCAGGCCG

G AGACGTCATCACCATTGACAAGGCCACCGGCAAGATCTCCAAGCTGGGCCGCTCTTTCACACGTGCACGGGACTACGACGCCATGGGCTCCCAG ACC

AAGTTTGTGCAGTGCCCAGACGGAGAGCTGCAGAAACGCAAGGAGGTGGTGCACACCGTGTCCCTCCATGAGATTGACGTCATCAACTCCCGTACTCAGG

GCTTCCTGGCCCTCTTCTCAG - UNI20287 - GAGACACAGGGGAGATCAAGTCAGAAGTCCGAGAACAGATCAATGCAAAGGTGGCTGAGTGGAGA

GAGGAGGGCAAGGCAGAGATCATTCCTGGG GTGCTGTTCATCGACGAGGTCCACATGCTGGACATTGAGAGTTTCTCTTTCCTCAACCGGGCCCTGGAG

AGCGACATGGCGCCTGTCCTCATCATGGCCACCAACCGAGGGATCACCCG GATCCGAGGCACCAGCTACCAGAGTCCCCACGGCATCCCCATCGACCTG

CTGGACCGCTTGCTCATTGTATCAACGTCACCCTACAGTGAGAAGGATACCAAGCAGATTCTGCGCATCCG CTGTGAGGAGGAAGATGTGGAGATGAGT

GAGGACGCCTACACAGTGCTGACCCGCATTGGGCTCGAGACCTCCCTGCGCTATGCCATCCAGCTCATCACAGCGGCCAGCCTGGTGTGCCGGAAACGAA

AG GGCACCGAGGTGCAGGTCGATGACATTAAGCGTGTATACTCCCTCTTCCTGGATGAATCCCGCTCCACACAGTACATGAAGGAGTACCAAGATGCCT

TCCTCTTCAATGAGCTCA AAGGCGAAACAATGGACACCTCCTGAGCTGACCTGACACCCCAGCCCTTCCCACCCCATTTTCTACAAGTTCTAACACTGT

GACTTTATATAAAATTATTGAAAACTG
Translation
MATV - UNI13274 - - UNI14841 - AATTKVPEIRDVTRIERIG - UNI14841 - GAHSHIRGLGLDDALEPRQ - UNI14841 - - U

NI23950 - - UNI29968 - ASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMG - UNI29968 - GMAQALGPDTPFTAI

AGSEIFSLEMSKTEALTQAFRRSIGVRIK - UNI29968 - KEETEIIEGEVVEIQIDRPATGT GSKVGKLTLKTTEMETIYDLGTKMIESLTKDKV

QAG GDVITIDKATGKISKLGRSFTRARDYDAMGSQ TKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSG - UNI20287 - GDTGEIK

SEVREQINAKVAEWREEGKAEIIPG VLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITR RIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKD

TKQILRIR RCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRK GTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK KGETMD

TS

For any suggestions or comments, please send an email to unitrap@crg.es