Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004069 (Dnaja3)
Chromosomal location
Chr 16: 4684123 - 4707691 (+)
Description
DnaJ (Hsp40) homolog, subfamily A, member 3 Gene [Source:MGI (curated);Acc:Dnaja3-001]
RefSeq_dna
NM_023646 
RefSeq_peptide
NP_076135.3 NP_001128584.1 
UniGene
Mm.325524 Mm.397807 Mm.248337 
MGI
MGI:1933786 
Uniprot/SWISSPROT
Q99M87 
Uniprot/SPTREMBL
Q3TJA9 
Human Ortholog
ENSG00000103423 (DNAJA3)
Omim not available
UniTrap UNI31793
Vector Insertion
Chr 16: 4684345 - 4687236
Public Clones IST11743D10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31311
Vector Insertion
Chr 16: 4687371 - 4689980
Public Clones IST10880A9 (tigm) IST12799C5 (tigm) IST12969B5 (tigm) IST12748G2 (tigm)
IST10783B5 (tigm) IST12247C10 (tigm) IST13310E3 (tigm) IST13264E10 (tigm)
IST10372C3 (tigm) IST13265B1 (tigm) IST10280B8 (tigm) IST13239D11 (tigm)
IST13171C6 (tigm) IST13150H7 (tigm) IST10301C12 (tigm) IST13919D8 (tigm)
IST10265H4 (tigm) IST10513H1 (tigm) IST13685B4 (tigm) IST12436G1 (tigm)
IST13436C5 (tigm) IST13353C3 (tigm) IST14433E11 (tigm) IST10204G4 (tigm)
IST14272G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9423
Vector Insertion
Chr 16: 4702309 - 4705843
Public Clones RRD005 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21065
Vector Insertion
Chr 16: 4705961 - 4706567
Public Clones not available
Private Clones OST342645 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115853
Sequence
CCCGGGCCAAAATGGCTGCGTGGTGTTCCCCACGCTGGTTGAGGGTGGCAGTGGGGACTCCCCGGCTGCCGGCTGCAGCGGGGAGAGGGGTCCAGCAGCC

CCAGGGGGGCGTAGTGGCAACATCCCTGTGTCGCAAGCTGTGCGTCTCTGCCTTCGGGCTTTCCATGGGCGCTCACGGCCCCCGGGCGCTGCTGACATTG

AGACCCGGTGTCCGCCTCACAG - UNI31793 - GAACAAAAAGTTTCCCTTTTGTTTGTACCACCTCTTTCCACACAAGTGCTTCTTTGGCCAAAGA

TGATTATTACCAGATCCTGGGAGTGCCCCGAAATGCCAGCCAGAAAGATATCAAGAAAGCCTATTATCAG - UNI31311 - CTTGCCAAGAAATATC

ATCCAGACACAAATAAGGATGATCCCAAAGCCAAGGAGAAGTTTTCCCAGCTGGCAGAAGCTTATGAG GTGTTGAGCGATGAAGTGAAGAGGAAGCAGT

ATGACGCTTACGGCTCTGCTGGCTTTGACCCTGGCACCAGCAGCTCTGGGCAGGGCTACTGGAGAGGAGGTCCCTCTGTTGACCCCGAGGAGTTGTTCAG

GAAGATCTTTGGGGAGTTCTCATCTTCTCCTTTTGGTGATTTCCAGAATGTGTTTGATCAGCCTCAGGAA GAAACTATCAATACAGGGCCTTTTGTGAT

GCGTTCCACATGTCGGAGATGTGGTGGCCGGGGCTCCATCATCACAAATCCCTGTGTGGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAGAAGCGCGTG

ACAATTCCTGTGCCTGCAG GAGTTGAAGATGGTCAGACTGTAAGGATGCCAGTGGGAAAACGAGAAATTTTTGTCACATTCAGG GTGCAGAAAAGCCC

TGTGTTCCGGAGGGACGGTGCAGACATCCACTCGGACCTCTTTATTTCAATAGCTCAAGCTATTCTTGGGGGCACAGCCAAAGCCCAGGGCCTGTATGAG

ACAATCAATGTGACG ATCCCTGCAGGGATTCAGACAGACCAGAAGATTCGTTTGACTGGAAAAGGCATCCCCCGGATTAATAGCTATGGCTATGGTGAC

CACTACATTCACATCAAGATCAGAGTTCCAAA GAGGCTGAGCAGTAGGCAGCAGAACCTGATCCTGAGCTATGCCGAGGATGAGACTGACGTGGAGGGG

ACGGTTAATGGAGTCACCCACACAAGCACTG - UNI9423 - GTGGCAGAACCATGGATAGCTCCGCAGGAAGCAAGGATAGGCGAGAGGCTGGGGAG

GACAATGAGGGATTCCTTTCCAAACTTAAGAAAATATTTACTTCCTGATACCCCTGCTGAG - UNI21065 - GAAAGCGGTCAACTGGAAACTAAAT

GGAGCAGCAGCTCCTCTCTGTGGCCAGGGCATCAGACACAGGAGGATCCCAGAACGGCAGCACTGAGCCCCTGCTCCCAGATCCCTCTGAACCGCCGAGC

AACAGCAAAACTATGTGACAACACTTCTCCGCATAAAGGTTATGGTGCCCTAGGCAGTGACATATGGCCTCAGGCTGGACACCGAGACAGGTGGAAATAC

CCTGTCCATTGGTAGATGTCTTGCTTCTTCTGGTTCAGGCAGGGAAAACACTTGGACTCTTCTTGCAGCACTAAAACTAACCTGGAATCGCATGTAGTAG

AGCTGAAAGAATTAAAGACCCGGCTTACAGCTTCAGATGAAGCTTTAAGCTGCAGTGTTGTGAAGTGATTAATTCCCTTTCTACCAACCCCGTGGGAGTT

CTACAGTACGGCTGTCCTGACACGGCTCTTGTCTAGGACCAGGGCGGCACATCCCACCAGCGCCATCTTCCTGGACAGAGTGAGCTGTCAGTCACTCCCC

AGGTTTTTTTTGTTTTTGGGGTTTTTTTTTTTTTGTACCAAGTAGCTAGAAAGTGGGACCTAGGGCCCTGGGAGGACACCTAGCAACAGCAGGTTCCATT

TCACCTCAGATGGCAGCTTGCCTGGCAGTGGACTTAGAGTGTTCTAGTCTGATGTATGTGGGGTTTCCTGCCCTGTTGGACCAAAGTTTCCATGGTCCTA

TGGGATAGCCTTCAGCCTCTGGAGACCCAGAGCTTGCCTGCCAGGGCTTGGTTCTCCATTTCCACTGCTGACATTTGATTTCCAGTGTATTTAAATTACT

CCGTGGTAAATTTCATTGTCTTTTCCTGTGTAAATGTTAAATGACAATACCATCGGTGAAGGCCCTCCACAGTGGACAGAGCAACTTCCTTTCCAGCCTC

TGCTGGTAGCATGCTGCAGCTTCTGTGTTAAAGGTCCTCTGGAGCTCGTGTAAGACAGGAAGAACACTTTCTCTGTAGTTTCTTTCTTTTCATTTATAAT

TTACAAAAGTAAAGCATTTATTAGTGTCTGATTTAAGAATGTAAAGTGATTCTGTATCAATGTAAATAAGATGATCTACTACAAAAGATATTTAAAATC
Translation
MAAWCSPRWLRVAVGTPRLPAAAGRGVQQPQGGVVATSLCRKLCVSAFGLSMGAHGPRALLTLRPGVRLTG - UNI31793 - GTKSFPFVCTTSFHT

SASLAKDDYYQILGVPRNASQKDIKKAYYQ - UNI31311 - LAKKYHPDTNKDDPKAKEKFSQLAEAYE VLSDEVKRKQYDAYGSAGFDPGTSSSG

QGYWRGGPSVDPEELFRKIFGEFSSSPFGDFQNVFDQPQE ETINTGPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTIPVPAG GVEDGQTV

RMPVGKREIFVTFR VQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLYETINVT IPAGIQTDQKIRLTGKGIPRINSYGYGDHYIHIKIRVPK K

RLSSRQQNLILSYAEDETDVEGTVNGVTHTSTG - UNI9423 - GGRTMDSSAGSKDRREAGEDNEGFLSKLKKIFTS - UNI21065 - 
Transcript ENSMUST00000060067
Sequence
CCCGGGCCAAAATGGCTGCGTGGTGTTCCCCACGCTGGTTGAGGGTGGCAGTGGGGACTCCCCGGCTGCCGGCTGCAGCGGGGAGAGGGGTCCAGCAGCC

CCAGGGGGGCGTAGTGGCAACATCCCTGTGTCGCAAGCTGTGCGTCTCTGCCTTCGGGCTTTCCATGGGCGCTCACGGCCCCCGGGCGCTGCTGACATTG

AGACCCGGTGTCCGCCTCACAG - UNI31793 - GAACAAAAAGTTTCCCTTTTGTTTGTACCACCTCTTTCCACACAAGTGCTTCTTTGGCCAAAGA

TGATTATTACCAGATCCTGGGAGTGCCCCGAAATGCCAGCCAGAAAGATATCAAGAAAGCCTATTATCAG - UNI31311 - CTTGCCAAGAAATATC

ATCCAGACACAAATAAGGATGATCCCAAAGCCAAGGAGAAGTTTTCCCAGCTGGCAGAAGCTTATGAG GTGTTGAGCGATGAAGTGAAGAGGAAGCAGT

ATGACGCTTACGGCTCTGCTGGCTTTGACCCTGGCACCAGCAGCTCTGGGCAGGGCTACTGGAGAGGAGGTCCCTCTGTTGACCCCGAGGAGTTGTTCAG

GAAGATCTTTGGGGAGTTCTCATCTTCTCCTTTTGGTGATTTCCAGAATGTGTTTGATCAGCCTCAGGAA TACATCATGGAATTGACATTCAATCAAGC

TGCCAAGGGTGTCAACAAAGAGTTCACTGTGAACATTATGGATACCTGTGAGCGCTGTGACGGCAAGGGGAACGAGCCTGGAACCAAAGTGCAGCATTGC

CATTACTGTGGCGGCTCGGGCATG GAAACTATCAATACAGGGCCTTTTGTGATGCGTTCCACATGTCGGAGATGTGGTGGCCGGGGCTCCATCATCACA

AATCCCTGTGTGGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAGAAGCGCGTGACAATTCCTGTGCCTGCAG GAGTTGAAGATGGTCAGACTGTAAGG

ATGCCAGTGGGAAAACGAGAAATTTTTGTCACATTCAGG GTGCAGAAAAGCCCTGTGTTCCGGAGGGACGGTGCAGACATCCACTCGGACCTCTTTATT

TCAATAGCTCAAGCTATTCTTGGGGGCACAGCCAAAGCCCAGGGCCTGTATGAGACAATCAATGTGACG ATCCCTGCAGGGATTCAGACAGACCAGAAG

ATTCGTTTGACTGGAAAAGGCATCCCCCGGATTAATAGCTATGGCTATGGTGACCACTACATTCACATCAAGATCAGAGTTCCAAA GAGGCTGAGCAGT

AGGCAGCAGAACCTGATCCTGAGCTATGCCGAGGATGAGACTGACGTGGAGGGGACGGTTAATGGAGTCACCCACACAAGCACTG - UNI9423 - GT

GGCAGAACCATGGATAGCTCCGCAGGAAGCAAGGATAGGCGAGAGGCTGGGGAGGACAATGAGGGATTCCTTTCCAAACTTAAGAAAATATTTACTTCCT

GATACCCCTGCTGAG - UNI21065 - GAAAGCGGTCAACTGGAAACTAAATGGAGCAGCAGCTCCTCTCTGTGGCCAGGGCATCAGACACAGGAGGA

TCCCAGAACGGCAGCACTGAGCCCCTGCTCCCAGATCCCTCTGAACCGCCGAGCAACAGCAAAACTATGTGACAACACTTCTCCGCATAAAGGTTATGGT

GCCCTAGGCAGTGACATATGGCCTCAGGCTGGACACCGAGACAGGTGGAAATACCCTGTCCATTGGTAGATGTCTTGCTTCTTCTGGTTCAGGCAGGGAA

AACACTTGGACTCTTCTTGCAGCACTAAAACTAACCTGGAATCGCATGTAGTAGAGCTGAAAGAATTAAAGACCCGGCTTACAGCTTCAGATGAAGCTTT

AAGCTGCAGTGTTGTGAAGTGATTAATTCCCTTTCTACCAACCCCGTGGGAGTTCTACAGTACGGCTGTCCTGACACGGCTCTTGTCTAGGACCAGGGCG

GCACATCCCACCAGCGCCATCTTCCTGGACAGAGTGAGCTGTCAGTCACTCCCCAGGTTTTTTTTGTTTTTGGGGTTTTTTTTTTTTTGTACCAAGTAGC

TAGAAAGTGGGACCTAGGGCCCTGGGAGGACACCTAGCAACAGCAGGTTCCATTTCACCTCAGATGGCAGCTTGCCTGGCAGTGGACTTAGAGTGTTCTA

GTCTGATGTATGTGGGGTTTCCTGCCCTGTTGGACCAAAGTTTCCATGGTCCTATGGGATAGCCTTCAGCCTCTGGAGACCCAGAGCTTGCCTGCCAGGG

CTTGGTTCTCCATTTCCACTGCTGACATTTGATTTCCAGTGTATTTAAATTACTCCGTGGTAAATTTCATTGTCTTTTCCTGTGTAAATGTTAAATGACA

ATACCATCGGTGAAGGCCCTCCACAGTGGACAGAGCAACTTCCTTTCCAGCCTCTGCTGGTAGCATGCTGCAGCTTCTGTGTTAAAGGTCCTCTGGAGCT

CGTGTAAGACAGGAAGAACACTTTCTCTGTAGTTTCTTTCTTTTCATTTATAATTTACAAAAGTAAAGCATTTATTAGTGTCTGATTTAAGAATGTAAAG

TGATTCTGTATCAATGTAAATAAGATGATCTACTACAAAAGATATTTAAAATC
Translation
MAAWCSPRWLRVAVGTPRLPAAAGRGVQQPQGGVVATSLCRKLCVSAFGLSMGAHGPRALLTLRPGVRLTG - UNI31793 - GTKSFPFVCTTSFHT

SASLAKDDYYQILGVPRNASQKDIKKAYYQ - UNI31311 - LAKKYHPDTNKDDPKAKEKFSQLAEAYE VLSDEVKRKQYDAYGSAGFDPGTSSSG

QGYWRGGPSVDPEELFRKIFGEFSSSPFGDFQNVFDQPQE YIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCGGSGM ETINTGP

FVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTIPVPAG GVEDGQTVRMPVGKREIFVTFR VQKSPVFRRDGADIHSDLFISIAQAILGGTAKA

QGLYETINVT IPAGIQTDQKIRLTGKGIPRINSYGYGDHYIHIKIRVPK KRLSSRQQNLILSYAEDETDVEGTVNGVTHTSTG - UNI9423 - GG

RTMDSSAGSKDRREAGEDNEGFLSKLKKIFTS - UNI21065 - 
Transcript ENSMUST00000115854
Sequence
ATGGCTGCGTGGTGTTCCCCACGCTGGTTGAGGGTGGCAGTGGGGACTCCCCGGCTGCCGGCTGCAGCGGGGAGAGGGGTCCAGCAGCCCCAGGGGGGCG

TAGTGGCAACATCCCTGTGTCGCAAGCTGTGCGTCTCTGCCTTCGGGCTTTCCATGGGCGCTCACGGCCCCCGGGCGCTGCTGACATTGAGACCCGGTGT

CCGCCTCACAG - UNI31793 - GAACAAAAAGTTTCCCTTTTGTTTGTACCACCTCTTTCCACACAAGTGCTTCTTTGGCCAAAGATGATTATTACC

AGATCCTGGGAGTGCCCCGAAATGCCAGCCAGAAAGATATCAAGAAAGCCTATTATCAG - UNI31311 - CTTGCCAAGAAATATCATCCAGACACA

AATAAGGATGATCCCAAAGCCAAGGAGAAGTTTTCCCAGCTGGCAGAAGCTTATGAG GTGTTGAGCGATGAAGTGAAGAGGAAGCAGTATGACGCTTAC

GGCTCTGCTGGCTTTGACCCTGGCACCAGCAGCTCTGGGCAGGGCTACTGGAGAGGAGGTCCCTCTGTTGACCCCGAGGAGTTGTTCAGGAAGATCTTTG

GGGAGTTCTCATCTTCTCCTTTTGGTGATTTCCAGAATGTGTTTGATCAGCCTCAGGAA TACATCATGGAATTGACATTCAATCAAGCTGCCAAGGGTG

TCAACAAAGAGTTCACTGTGAACATTATGGATACCTGTGAGCGCTGTGACGGCAAGGGGAACGAGCCTGGAACCAAAGTGCAGCATTGCCATTACTGTGG

CGGCTCGGGCATG GAAACTATCAATACAGGGCCTTTTGTGATGCGTTCCACATGTCGGAGATGTGGTGGCCGGGGCTCCATCATCACAAATCCCTGTGT

GGTCTGCAGGGGAGCAGGACAAGCCAAGCAGAAGAAGCGCGTGACAATTCCTGTGCCTGCAG GAGTTGAAGATGGTCAGACTGTAAGGATGCCAGTGGG

AAAACGAGAAATTTTTGTCACATTCAGG GTGCAGAAAAGCCCTGTGTTCCGGAGGGACGGTGCAGACATCCACTCGGACCTCTTTATTTCAATAGCTCA

AGCTATTCTTGGGGGCACAGCCAAAGCCCAGGGCCTGTATGAGACAATCAATGTGACG ATCCCTGCAGGGATTCAGACAGACCAGAAGATTCGTTTGAC

TGGAAAAGGCATCCCCCGGATTAATAGCTATGGCTATGGTGACCACTACATTCACATCAAGATCAGAGTTCCAAA GAGGCTGAGCAGTAGGCAGCAGAA

CCTGATCCTGAGCTATGCCGAGGATGAGACTGACGTGGAGGGGACGGTTAATGGAGTCACCCACACAAGCACTG - UNI9423 - - UNI21065 - 

GAAAGCGGTCAACTGGAAACTAAATGGAGCAGCAGCTCCTCTCTGTGGCCAGGGCATCAGACACAGGAGGATCCCAGAACGGCAGCACTGAGCCCCTGCT

CCCAGATCCCTCTGAACCGCCGAGCAACAGCAAAACTATGTGACAACACTTCTCCGCATAAAGGTTATGGTGCCCTAGGCAGTGACATATGGCCTCAGGC

TGGACACCGAGACAGGTGGAAATACCCTGTCCATTGGTAGATGTCTTGCTTCTTCTGGTTCAGGCAGGGAAAACACTTGGACTCTTCTTGCAGCACTAAA

ACTAACCTGGAATCGCATGTAGTAGAGCTGAAAGAATTAAAGACCCGGCTTACAGCTTCAGATGAAGCTTTAAGCTGCAGTGTTGTGAAGTGATTAATTC

CCTTTCTACCAACCCCGTGGGAGTTCTACAGTACGGCTGTCCTGACACGGCTCTTGTCTAGGACCAGGGCGGCACATCCCACCAGCGCCATCTTCCTGGA

CAGAGTGAGCTGTCAGTCACTCCCCAGGTTTTTTTTGTTTTTGGGGTTTTTTTTTTTTTGTACCAAGTAGCTAGAAAGTGGGACCTAGGGCCCTGGGAGG

ACACCTAGCAACAGCAGGTTCCATTTCACCTCAGATGGCAGCTTGCCTGGCAGTGGACTTAGAGTGTTCTAGTCTGATGTATGTGGGGTTTCCTGCCCTG

TTGGACCAAAGTTTCCATGGTCCTATGGGATAGCCTTCAGCCTCTGGAGACCCAGAGCTTGCCTGCCAGGGCTTGGTTCTCCATTTCCACTGCTGACATT

TGATTTCCAGTGTATTTAAATTACTCCGTGGTAAATTTCATTGTCTTTTCCTGTGTAAATGTTAAATGACAATACCATCGGTGAAGGCCCTCCACAGTGG

ACAGAGCAACTTCCTTTCCAGCCTCTGCTGGTAGCATGCTGCAGCTTCTGTGTTAAAGGTCCTCTGGAGCTCGTGTAAGACAGGAAGAACACTTTCTCTG

TAGTTTCTTTCTTTTCATTTATAATTTACAAAAGTAAAGCATTTATTAGTGTCTGATTTAAGAATGTAAAGTGATTCTGTATCAATGTAAATAAGATGAT

CTACTACAAAAGATATTTAAAATC
Translation
MAAWCSPRWLRVAVGTPRLPAAAGRGVQQPQGGVVATSLCRKLCVSAFGLSMGAHGPRALLTLRPGVRLTG - UNI31793 - GTKSFPFVCTTSFHT

SASLAKDDYYQILGVPRNASQKDIKKAYYQ - UNI31311 - LAKKYHPDTNKDDPKAKEKFSQLAEAYE VLSDEVKRKQYDAYGSAGFDPGTSSSG

QGYWRGGPSVDPEELFRKIFGEFSSSPFGDFQNVFDQPQE YIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCGGSGM ETINTGP

FVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTIPVPAG GVEDGQTVRMPVGKREIFVTFR VQKSPVFRRDGADIHSDLFISIAQAILGGTAKA

QGLYETINVT IPAGIQTDQKIRLTGKGIPRINSYGYGDHYIHIKIRVPK KRLSSRQQNLILSYAEDETDVEGTVNGVTHTSTG - UNI9423 - - 

UNI21065 - GKRSTGN

For any suggestions or comments, please send an email to unitrap@crg.es