Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004207 (Psap)
Chromosomal location
Chr 10: 59740375 - 59765342 (+)
Description
prosaposin Gene [Source:MGI (curated);Acc:Psap-001]
RefSeq_dna
NM_011179 
RefSeq_peptide
NP_035309.2 
UniGene
Mm.277498 Mm.446546 
MGI
MGI:97783 
Uniprot/SWISSPROT
Q61207 
Uniprot/SPTREMBL
Q3TID4 Q3TIT5 Q3TKB2 Q3TKK3 Q3TWE9 Q3TWF9 Q3TWL8 Q3TWM9 Q3TXJ0 Q3TXP9 Q3U5W2 Q3U825 Q3U897 Q3U8C4 Q3UAS4 Q3UE29 Q8BFQ1 B2RUD7 Q3UFE8 
Human Ortholog
ENSG00000197746 (PSAP)
Omim 249900 - METACHROMATIC LEUKODYSTROPHY DUE TO SAPOSIN B DEFICIENCY  610539 - GAUCHER DISEASE, ATYPICAL, DUE TO SAPOSIN C DEFICIENCY  611721 - COMBINED SAPOSIN DEFICIENCY  611722 - KRABBE DISEASE, ATYPICAL, DUE TO SAPOSIN A DEFICIENCY  
UniTrap UNI11204
Vector Insertion
Chr 10: 59740531 - 59754386
Public Clones G085E10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32899
Vector Insertion
Chr 10: 59740531 - 59754386
Public Clones IST11996A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37214
Vector Insertion
Chr 10: 59754521 - 59755252
Public Clones CMHD-GT_499G7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9196
Vector Insertion
Chr 10: 59758751 - 59760284
Public Clones RST477 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105465
Sequence
AGTTTGGGCGGGGCCCGCGCCTGCGCACTGGCGTCTGCGGCGAGGTTGGGGGGTAGATTTATATTCGTCTGGTCAGCTGACGTTCTGCATTGCAGCCTGC

GAAGTGAAGCGGCGCCATGTACGCCCTCGCCCTCTTCGCCAGCCTTCTGGCCACCG - UNI11204 - - UNI32899 - CTCTGACCAGCCCTGTC

CAAGACCCGAAGACATGCTCTGGGGGCTCAGCAGTGCTGTGCAGAGATGTGAAGACGGCGGTGGACTGTGGGGCCGTGAAGCACTGCCAGCAGATGGTCT

GGAGCAAGCCCACAGCG AAATCCCTTCCTTGCGACATATGCAAAACTGTTGTCACCGAAGCTGGGAACTTGCTGAAAGATAATGCTACGCAG GAGGAG

ATCCTTCATTACCTGGAGAAGACCTGTGAGTGGATTCATGACTCCAGCCTGTCGGCCTCGTGCAAGGAGGTGGTTGACTCTTACCTGCCTGTCATCCTGG

ACATGATTAAGGGCGAGATG AGCAACCCTGGGGAAGTGTGCTCTGCGCTCAACCTCTGCCAGTCCCTTCAGGAGTACTTGGCCGAGCAAAACCAGAAAC

AGCTTGAGTCCAACAAGATCCCGGAGGTGGACATGGCCCGTGTGGTTGCCCCCTTCATGTCCAACATCCCTCTCCTGCTGTACCCTCAGGATCACCCCCG

CAGCCAGCCCCAACCTAAG GCTAACGAGGACGTCTGCCAGGACTGTATGAAGCTGGTGTCTGATGTCCAGACTGCTGTGAAGACCAACTCCAGCTTTAT

CCAGGGCTTCGTGGACCACGTGAAGGAGGATTGTGACCGCTTGGGGCCAGGCGTGTCTGACATA TGCAAGAACTACGTGGACCAGTATTCCGAGGTCTG

TGTCCAGATGTTGATGCACATG - UNI9196 - CAACCCAAGGAAATCTGTGTGCTGGCTGGCTTCTGTAATGAGGTCAAGAGAGTGCCAATGAAGAC

TCTGGTCCCTGCCACCGAGACCATTAAGAACATCCTCCCTGCCCTGGAGATGATGGACCCCTATGAG CAGAATCTGGTCCAGGCCCACAATGTGATTTT

ATGCCAGACCTGTCAGTTTGTGATGAATAAGTTTTCTGAGCTGATTGTCAATAATGCCACTGAG GAGCTCCTAGTTAAAGGTTTGAGCAACGCATGCGC

ACTGCTCCCCGATCCTGCCAGAACCAAGTGCCAGGAGGTGGTGGGAACATTTGGCCCCTCCCTGTTGGACATCTTTATCCATGAGGTAAACCCCAGCTCT

CTGTGCGGTGTGATCGGCCTCTGTGCTGCCCGCCCGGAGTTGGTGGAGGCACTTGAGCAGCCTGCGCCAGCCATTGTATCTGCACTGCTCAAAGAGCCCA

CACCGCCAAAGCAGCCCGCACAGCCCAAGCAGTCGGCATTGCCCG CCCATGTGCCTCCTCAGAAGAATGGTGGGTTCTGTGAGGTGTGCAAGAAACTGG

TCCTCTATTTGGAACATAACCTGGAGAAAAACAGCACCAAGGAGGAAATCCTGGCCGCACTTGAGAAGGGCTGCAGCTTCCTGCCAGACCCTTACCAGAA

GCAG TGCGATGACTTTGTGGCTGAGTATGAGCCCTTGCTATTGGAGATCCTCGTGGAAGTGATGGATCCTGGATTTGTGTGCTCG AAAATTGGAGTTT

GCCCTTCTGCCTATAAGCTGCTGCTGGGAACCGAGAAGTGTGTCTGGGGCCCTAGCTACTGGTGTCAGAACATGGAGACTGCCGCCCGATGCAAT GCTG

TCGATCATTGCAAACGCCATGTGTGGAACTAGTTTCCCAGCTGCAGAAGTCACCTACTTGTGGGTCTAGGGTAATGAACACATAGATCTATTTGACTTAA

TAAGTAGGAACCCCCTTTGCCCTTCCCCCATCTCCTCTCCCTTACTGTAGCATTTCTGTCATGTAAGAGGTGCTGACAGCCACTTCCGTGTCCCCTTTCT

GCTCGAAGGATGAGGATACCTTGGGCATCAGCTCCCCGGCTGCCCTTTTCACCCACCTGCTGGAGGGGGGTGGTGAGCCAGAGGGCAGGAGCATTTTCTG

AGCCCTTTCTTGGTGTGTGGGGGATCTATGGCCATCTCCTACCATGAGGGAGCTACCCAGCTTCCTGTGGTACCAAGGAGTTATTTTGGATGATTAGAAG

CACAGAATGATCAGGCCTTTAGAGCGATGGAATGGCCATTGTCATAGCACAGAGATTTCAGAAGCACCTGCAGGTGGCTTGCTTGGGATGTTGCTGTCCC

TGGGTCAGCCTTCCATTCTGCTTTCCTGTCTTCCCGTCTGCCTTGTTGGGGTTCTGTGGGGTAGGGTGGGGAGGGGAAACTTGTGAATGTAACTTGCCTG

TGCCGTGTGACGGTCACGTGGGCCTGGTCTTTTGTGTGTGAGGCCCTTGACCGTGTGGCCTCTGCCTGGCTGTTTGGGGTCCTGCACGGCTTTCCCACCA

CCTGTAGCTCTTGTTGACCTGCCTGTTCACCTCATGAGTGAAGCGTCTGCCTGGCAGTGGGCCATGAACTGAGGGGTCTCTGTGTAGAGTAGAAGCTTCC

TGTGCCTCCGGTTGCCAGGAGACAGCCTGTGCAGTTAAATGGACCTAGATTTTGTTTTGCACTAAAGTTTCTGTGACTTAATAAAGTTCTGTTAACC
Translation
MYALALFASLLATA - UNI11204 - - UNI32899 - ALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTA KSLPCDICKTVVT

EAGNLLKDNATQ EEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEM SNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAP

FMSNIPLLLYPQDHPRSQPQPK ANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDI CKNYVDQYSEVCVQMLMHM - UNI919

6 - QPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYE QNLVQAHNVILCQTCQFVMNKFSELIVNNATE ELLVKGLSNACALLPDPA

RTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPA AHVPPQKNGGFCEVCKKLVLYLE

HNLEKNSTKEEILAALEKGCSFLPDPYQKQ CDDFVAEYEPLLLEILVEVMDPGFVCS KIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCN AVDH

CKRHVWN
Transcript ENSMUST00000004316
Sequence
GCATTGCAGCCTGCGAAGTGAAGCGGCGCCATGTACGCCCTCGCCCTCTTCGCCAGCCTTCTGGCCACCG - UNI11204 - - UNI32899 - CTC

TGACCAGCCCTGTCCAAGACCCGAAGACATGCTCTGGGGGCTCAGCAGTGCTGTGCAGAGATGTGAAGACGGCGGTGGACTGTGGGGCCGTGAAGCACTG

CCAGCAGATGGTCTGGAGCAAGCCCACAGCG AAATCCCTTCCTTGCGACATATGCAAAACTGTTGTCACCGAAGCTGGGAACTTGCTGAAAGATAATGC

TACGCAG GAGGAGATCCTTCATTACCTGGAGAAGACCTGTGAGTGGATTCATGACTCCAGCCTGTCGGCCTCGTGCAAGGAGGTGGTTGACTCTTACCT

GCCTGTCATCCTGGACATGATTAAGGGCGAGATG AGCAACCCTGGGGAAGTGTGCTCTGCGCTCAACCTCTGCCAGTCCCTTCAGGAGTACTTGGCCGA

GCAAAACCAGAAACAGCTTGAGTCCAACAAGATCCCGGAGGTGGACATGGCCCGTGTGGTTGCCCCCTTCATGTCCAACATCCCTCTCCTGCTGTACCCT

CAGGATCACCCCCGCAGCCAGCCCCAACCTAAG GCTAACGAGGACGTCTGCCAGGACTGTATGAAGCTGGTGTCTGATGTCCAGACTGCTGTGAAGACC

AACTCCAGCTTTATCCAGGGCTTCGTGGACCACGTGAAGGAGGATTGTGACCGCTTGGGGCCAGGCGTGTCTGACATA TGCAAGAACTACGTGGACCAG

TATTCCGAGGTCTGTGTCCAGATGTTGATGCACATG - UNI9196 - CAGGATCAG CAACCCAAGGAAATCTGTGTGCTGGCTGGCTTCTGTAATGA

GGTCAAGAGAGTGCCAATGAAGACTCTGGTCCCTGCCACCGAGACCATTAAGAACATCCTCCCTGCCCTGGAGATGATGGACCCCTATGAG CAGAATCT

GGTCCAGGCCCACAATGTGATTTTATGCCAGACCTGTCAGTTTGTGATGAATAAGTTTTCTGAGCTGATTGTCAATAATGCCACTGAG GAGCTCCTAGT

TAAAGGTTTGAGCAACGCATGCGCACTGCTCCCCGATCCTGCCAGAACCAAGTGCCAGGAGGTGGTGGGAACATTTGGCCCCTCCCTGTTGGACATCTTT

ATCCATGAGGTAAACCCCAGCTCTCTGTGCGGTGTGATCGGCCTCTGTGCTGCCCGCCCGGAGTTGGTGGAGGCACTTGAGCAGCCTGCGCCAGCCATTG

TATCTGCACTGCTCAAAGAGCCCACACCGCCAAAGCAGCCCGCACAGCCCAAGCAGTCGGCATTGCCCG CCCATGTGCCTCCTCAGAAGAATGGTGGGT

TCTGTGAGGTGTGCAAGAAACTGGTCCTCTATTTGGAACATAACCTGGAGAAAAACAGCACCAAGGAGGAAATCCTGGCCGCACTTGAGAAGGGCTGCAG

CTTCCTGCCAGACCCTTACCAGAAGCAG TGCGATGACTTTGTGGCTGAGTATGAGCCCTTGCTATTGGAGATCCTCGTGGAAGTGATGGATCCTGGATT

TGTGTGCTCG AAAATTGGAGTTTGCCCTTCTGCCTATAAGCTGCTGCTGGGAACCGAGAAGTGTGTCTGGGGCCCTAGCTACTGGTGTCAGAACATGGA

GACTGCCGCCCGATGCAAT GCTGTCGATCATTGCAAACGCCATGTGTGGAACTAGTTTCCCAGCTGCAGAAGTCACCTACTTGTGGGTCTAGGGTAATG

AACACATAGATCTATTTGACTTAATAAGTAGGAACCCCCTTTGCCCTTCCCCCATCTCCTCTCCCTTACTGTAGCATTTCTGTCATGTAAGAGGTGCTGA

CAGCCACTTCCGTGTCCCCTTTCTGCTCGAAGGATGAGGATACCTTGGGCATCAGCTCCCCGGCTGCCCTTTTCACCCACCTGCTGGAGGGGGGTGGTGA

GCCAGAGGGCAGGAGCATTTTCTGAGCCCTTTCTTGGTGTGTGGGGGATCTATGGCCATCTCCTACCATGAGGGAGCTACCCAGCTTCCTGTGGTACCAA

GGAGTTATTTTGGATGATTAGAAGCACAGAATGATCAGGCCTTTAGAGCGATGGAATGGCCATTGTCATAGCACAGAGATTTCAGAAGCACCTGCAGGTG

GCTTGCTTGGGATGTTGCTGTCCCTGGGTCAGCCTTCCATTCTGCTTTCCTGTCTTCCCGTCTGCCTTGTTGGGGTTCTGTGGGGTAGGGTGGGGAGGGG

AAACTTGTGAATGTAACTTGCCTGTGCCGTGTGACGGTCACGTGGGCCTGGTCTTTTGTGTGTGAGGCCCTTGACCGTGTGGCCTCTGCCTGGCTGTTTG

GGGTCCTGCACGGCTTTCCCACCACCTGTAGCTCTTGTTGACCTGCCTGTTCACCTCATGAGTGAAGCGTCTGCCTGGCAGTGGGCCATGAACTGAGGGG

TCTCTGTGTAGAGTAGAAGCTTCCTGTGCCTCCGGTTGCCAGGAGACAGCCTGTGCAGTTAAATGGACCTAGATTTTGTTTTGCACTAAAGTTTCTGTGA

CTTAATAAAGTTCTGTTAACC
Translation
MYALALFASLLATA - UNI11204 - - UNI32899 - ALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTA KSLPCDICKTVVT

EAGNLLKDNATQ EEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEM SNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAP

FMSNIPLLLYPQDHPRSQPQPK ANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDI CKNYVDQYSEVCVQMLMHM - UNI919

6 - QDQ QPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYE QNLVQAHNVILCQTCQFVMNKFSELIVNNATE ELLVKGLSNACALL

PDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPA AHVPPQKNGGFCEVCKKLV

LYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQ CDDFVAEYEPLLLEILVEVMDPGFVCS KIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCN 

AVDHCKRHVWN

For any suggestions or comments, please send an email to unitrap@crg.es