Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004221 (Ikbkg)
Chromosomal location
Chr X: 71669943 - 71699193 (+)
Description
inhibitor of kappaB kinase gamma Gene [Source:MGI (curated);Acc:Ikbkg-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35719
Vector Insertion
Chr X: 71675161 - 71678143
Public Clones IST15052H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064407
Sequence
ACTGCAGAGAAGGGAAGGGTGACCGCCTGACTAGGACTTTCTAGGAGCTCCGGTTCTGTCGGAGCGGTCGGATCCCTCTGCTCCTGCCCTCTTCACTTCT

GGCCGACTCTGCTGACAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACCAGCTGAGTGAGATGGTGCAGCCCAGTGG

TGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTACTCCTGAGACCCTC

CAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACGCTGTGAGGAGCTGCTGCATTTCCAGGTC

AGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCGGAGTCAGA

GGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG ATGGCTGAGGACAAGGCCTCTGTGAAAGCTCAGGTGACATCATTGCTCGGAG

AACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATTCGAGCAGTTAGTGAGCAGGTCAGACAGCTGG

AGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAGGCTGCCTTGCGAATGGAGCGGCA

GGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACTACGACAGCCACATTAAGAGCAGCAAG GGCA

TGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAGGCTGAGCAGCA

CAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAGCTGAGAGGCATGCCCGGGAGAAGCTGGTGGA

GAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAG GATTGAGGATATGAG

GAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGGCCTTGTCCAACCAGCGGAGGAGCCCTCCTGA

AGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACATGTCATGGAGTGCATAGAGTAGGAGCAGCAG

ATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGTCCACACTTAAGGGCTTGCTTTAGCCCTTTGG

TCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTCTGGTGGCTTCTTCCCTCTTCTCCCATAGTCC

TAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGCTTTTCTTCTCTCCAACTGGTACCTTTCTTGC

CGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAGACATGTGGAAAGTATTCTGTCCTTTTGTTAC

TGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCTTAGATGTGACATTGGATCCTTGCCCTGGAGGAGGTG

GGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAGTGTCTTTTTCTGGGGCATGTGGGCCCTTTTTAATTC

CTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTTCTTGGGCTTTGTAGAGCTTTTTGATTATCAGTCAGG

TTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCCACATTGATTGTTAGTGTTTTGGGGCCTAGAAGCTGTTTTATACTCCTACTTACCCATTCTTTA

CTCCTAGTTTTTTGACTTTGGAATTATGACTGCTTTGTCAACAGAAAGGTATTTCACATGTATGCTTTCCTTTTTCTAGCCCCAGTGTGCTCTTGTTTTT

GCCAAGCACATTGTTACCTTCTGTGAATGGTGGTGGCCATAGTTCATCACACTCCTGGAGTTTGTGATCACATGTTCTTCACCAGCCAAAATGTCCTAGG

GAACCATTTAGCAGTGACTGACTGATCACAGAAAAGGGAACACTTCACTTGTTTTGCAAGGTTCTAGACATTTTGTGGGACCTTACCGTCATTGGTATTA

GACCTGCAGTTCTAGTAAAGGAAAGGAAGTTGTAGTTGAGAAAGCAATAAATATGCCTTGCTCATTCCTTAGGTCTAAATCCTTCCTGCCCTCCTGTAAG

CTTTCATGGTTCTGAGTGGTATCTGTGAATCCATCCCGGGGGCTTTTATTTACATGGTTTCTTTCCCATTAAGAGTGAGAAGGCTAAGTAGAATTCAGAT

TATAAAAAAGGATTTAAAAAGTAATCCTGAGCTGGGGGCTTTCTCGGAATTTTCAGGGGATGCAGAGTAAGTTTTCCATTTCCTAATTCCCAGGTATCTA

TCAGAAAGATCTTTAGGAAAATGTTAAAGGAACAAACAAGTTCTTTGCTTATGTGTTTTCATTTAAATACCTAATCTATAATTTTCCTTTAGGAATACTA

TTGGTTTAGGTTGAGTCCAGTTTTGTGGTGGTATATATCACTTTTCTATAGCTGCTTTAAAATTTTTCCTAAACTTGGAAGAGCAAGAACAACAACAACA

ACAACAACAACAACAAATCACTCTTTCCTGTCTGGAAGCCACATATTAAGTTTTTTCTGGAGGCTGTGAGAATCAATTCCAGGCATTCTCTTAACTTTCA

GTGGTTTGTGGTAGTCCTTGGTGTTGCTTGGCTCATAGACCCATCACTCCAGTTTCTGGTTCTAGGGCCTTGTGGTTTCTTCCTCTCTTCTGTCTCATAA

GGAAACCATGTTGTGCATGTGGGGTCTATTTGATTAGATTAAGGAGGATCTCCAGTTCAAGACCCTTAACTCATTCCACCTACCAAGATCCTTTCCCCAA

ATAAAGTCTTGTTCTCACATTATGGGGGTTTGGGCTTATATAACCCGGAGTATGGATATCATCAGAACCTGAGTAAATGCAGCCCAAAGGCAGGGCCTTT

AAAGCCTTGTAATTCTGCTAGAGAGACCTGGTCTCTAGGGTGATGACCAGTAGTCTTCAGAGTTTGAAGGCAGACCCTTGTCAGTGCTTGATGCTGTTAG

TAGGGTCAGTGGGAATGATTGGGAAAGGCAGGTTGGCTATAGTAGGAGAGAGCTGTTGGGCTGCCTGCAGTGGCTGCATGAGCTTCACGCTTCTTGGATA

AACAGAGATGCATAGGTGCATTTCTGACCAGTACTTTATCCTGAAAGGGTCCCAGAAAGCAGGTGTGACCCAGGTTACACAGTAGGAAGCTTGAAAACAT

GGGCTTCATGCACTGGTCAAGACAAATCTGAGGGTGGCACAAGGTAATGGTTGGGACCTAGTACCCTTCTAGAAGGTGGGAGCCCTTGCCACCGACTTAC

CCTGCAGTATGGTGTATGATTAACCGTACATCAAAGATTTGAGATTCTACCATCTTTTTGACATGAGACATGCTCTTTTCTTTTGCAGAATTACTTAAGC

TAGAACTGGAAAAAGTGGTCGTTCCATTCCCCTCAGGAATTAGTCTACTTGCTTTTGCACAAATTTTATGTGGCCTCTGGCAGACAACTTTTAGATCCAT

ACAGCTAGAAGCATGCCCTTTCCAGAAGACCTGTTCTGGAATAGATAGTGCTTCTTATGTATGCTCTCTTCCTGTTGGCCCATGCCCAAGAGAAAACCAG

AGAGCCAGTAAGACAGTACAGAGTGCTTCACCTACTGAAGTAATAAACGATAAGGCAGATTGTAGGTAGGAATGATATCTAAAAAGGAACAATTGCAGCC

CTGTGTGTGACACCCTCAGGCAAGGTAAGGCCTACCTTTTAGTGTTTCCCCTTTCAAGGTGGGAGTTTGGAGAGATGAACAAGCACTTTGGAAGCATCCC

CAGCCCTCTTTACCTGACAACAGTTTGGTCCTCACAGTGACTGCTTCATTGGAGTGCCTCTCCAGTGTTATGGCACCATCATCTGTTACCACCCAAGGCT

GTGATGAAATAAGATACAACATATCCGATGACACAGGCCTGCATGGCTAGCATCTTGAACATTTTATTACATGAACATTCTCTGTACGATGGTATAAAAA

GGCCCGAGGATTAAATTATGTATAAAATATGAAATAAAGAAGTAAGACTTTC
Translation
 - UNI35719 - MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQMLRERCEELLHFQV

SQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ MAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGR RIRAVSEQVR

QLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQLQQAEEALVAKQELIDKLKE

EAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVETPQPPLLPAPA AHHSFHLAL

SNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Transcript ENSMUST00000114127
Sequence
TTACGACACCGGAAGCCGGAAGTGGAGTTTTCCACTGCAGAGAAGGGAAGGGTGACCGCCTGACTAGGACTTTCTAGGAGCTCCGGTTCTGTCGGAGCGG

TCGGATCCCTCTGCTCCTGCCCTCTTCACTTCTGGCCGACTCTGCTGACAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAA

GAACCAGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACAT

CTGCCTTCAGAGCAGGGTACTCCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGG

GAACGCTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGAC

TGAGCTTGGAGAAGCTTGATCTTCGGAGTCAGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG CAGATGGCTGAGGACAAGG

CCTCTGTGAAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG

 GATTCGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAA

CCAGAGCGTGGAGGCTGCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCA

AGACTACGACAGCCACATTAAGAGCAGCAAG GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGA

ATTGATTGATAAGCTGAAAGAGGAGGCTGAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTT

CCAAGCTGAGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTT

GGCTGCCATGAGTCAGCCAG GATTGAGGATATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCA

TTTGGCCTTGTCCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAG

ATACATGTCATGGAGTGCATAGAGTAGGAGCAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGC

ATAGTCCACACTTAAGGGCTTGCTTTAGCCCTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTT

GCCTCTGGTGGCTTCTTCCCTCTTCTCCCATAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGT

ACAGCTTTTCTTCTCTCCAACTGGTACCTTTCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCT

GGTAGACATGTGGAAAGTATTCTGTCCTTTTGTTACTGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCT

TAGATGTGACATTGGATCCTTGCCCTGGAGGAGGTGGGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAG

TGTCTTTTTCTGGGGCATGTGGGCCCTTTTTAATTCCTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTT

CTTGGGCTTTGTAGAGCTTTTTGATTATCAGTCAGGTTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCCACATTGATTGTTAGTGTTTTGGGGCCT

AGAAGCTGTTTTATACTCCTACTTACCCATTCTTTACTCCTAGTTTTTTGACTTTGGAATTATGACTGCTTTGTCAACAGAAAGGTATTTCACATGTATG

CTTTCCTTTTTCTAGCCCCAGTGTGCTCTTGTTTTTGCCAAGCACATTGTTACCTTCTGTGAATGGTGGTGGCCATAGTTCATCACACTCCTGGAGTTTG

TGATCACATGTTCTTCACCAGCCAAAATGTCCTAGGGAACCATTTAGCAGTGACTGACTGATCACAGAAAAGGGAACACTTCACTTGTTTTGCAAGGTTC

TAGACATTTTGTGGGACCTTACCGTCATTGGTATTAGACCTGCAGTTCTAGTAAAGGAAAGGAAGTTGTAGTTGAGAAAGCAATAAATATGCCTTGCTCA

TTCCTTAGGTCTAAATCCTTCCTGCCCTCCTGTAAGCTTTCATGGTTCTGAGTGGTATCTGTGAATCCATCCCGGGGGCTTTTATTTACATGGTTTCTTT

CCCATTAAGAGTGAGAAGGCTAAGTAGAATTCAGATTATAAAAAAGGATTTAAAAAGTAATCCTGAGCTGGGGGCTTTCTCGGAATTTTCAGGGGATGCA

GAGTAAGTTTTCCATTTCCTAATTCCCAGGTATCTATCAGAAAGATCTTTAGGAAAATGTTAAAGGAACAAACAAGTTCTTTGCTTATGTGTTTTCATTT

AAATACCTAATCTATAATTTTCCTTTAGGAATACTATTGGTTTAGGTTGAGTCCAGTTTTGTGGTGGTATATATCACTTTTCTATAGCTGCTTTAAAATT

TTTCCTAAACTTGGAAGAGCAAGAACAACAACAACAACAACAACAACAACAAATCACTCTTTCCTGTCTGGAAGCCACATATTAAGTTTTTTCTGGAGGC

TGTGAGAATCAATTCCAGGCATTCTCTTAACTTTCAGTGGTTTGTGGTAGTCCTTGGTGTTGCTTGGCTCATAGACCCATCACTCCAGTTTCTGGTTCTA

GGGCCTTGTGGTTTCTTCCTCTCTTCTGTCTCATAAGGAAACCATGTTGTGCATGTGGGGTCTATTTGATTAGATTAAGGAGGATCTCCAGTTCAAGACC

CTTAACTCATTCCACCTACCAAGATCCTTTCCCCAAATAAAGTCTTGTTCTCAC
Translation
 - UNI35719 - MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQMLRERCEELLHFQV

SQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ QMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGR RIRAVSEQV

RQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQLQQAEEALVAKQELIDKLK

EEAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVETPQPPLLPAPA AHHSFHLA

LSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Transcript ENSMUST00000114133
Sequence
CTTGTTCTCTTTGGGATTAACAAGACATAGAACCTGCTCTCCTTGTTTTGGCTCAGCCTGCAACTGACAGTCTGCCTGGCTTCAAGTCACCCAAGGGAGG

TGAG GAGGAAGAAGTGCTACTGGGTGGTGCTTTAGCACCTGTGATGGTCCAAGTCTGGTCTCCACTCAATGGCTCAGCACAGAGTTCTGAGATGTGACA

CAAGTACATGTATATCAGGTACTGCTGTGATGATCAGGACACACAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACC

AGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCC

TTCAGAGCAGGGTACTCCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACG

CTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGC

TTGGAGAAGCTTGATCTTCGGAGTCAGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG CAGATGGCTGAGGACAAGGCCTCT

GTGAAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATT

CGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGA

GCGTGGAGGCTGCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACT

ACGACAGCCACATTAAGAGCAGCAAG GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGA

TTGATAAGCTGAAAGAGGAGGCTGAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAG

CTGAGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTG

CCATGAGTCAGCCAG GATTGAGGATATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGG

CCTTGTCCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACA

TGTCATGGAGTGCATAGAGTAGGAGCAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGT

CCACACTTAAGGGCTTGCTTTAGCCCTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTC

TGGTGGCTTCTTCCCTCTTCTCCCATAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGC

TTTTCTTCTCTCCAACTGGTACCTTTCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAG

ACATGTGGAAAGTATTCTGTCCTTTTGTTACTGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCTTAGAT

GTGACATTGGATCCTTGCCCTGGAGGAGGTGGGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAGTGTCT

TTTTCTGGGGCATGTGGGCCCTTTTTAATTCCTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTTCTTGG

GCTTTGTAGAGCTTTTTGATTATCAGTCAGGTTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCCACATTGATTGTTAGTGTTTTGGGGCCTAGAAG

CTGTTTTATACTCCTACTTACCCATTCTTTACTCCTAGTTTTTTGACTTTGGAATTATGACTGCTTTGTCAACAGAAAGGTATTTCACATGTATGCTTTC

CTTTTTCTAGCCCCAGTGTGCTCTTGTTTTTGCCAAGCACATTGTTACCTTCTGTGAATGGTGGTGGCCATAGTTCATCACACTCCTGGAGTTTGTGATC

ACATGTTCTTCACCAGCCAAAATGTCCTAGGGAACCATTTAGCAGTGACTGACTGATCACAGAAAAGGGAACACTTCACTTGTTTTGCAAGGTTCTAGAC

ATTTTGTGGGACCTTACCGTCATTGGTATTAGACCTGCAGTTCTAGTAAAGGAAAGGAAGTTGTAGTTGAGAAAGCAATAAATATGCCTTGCTCATTCCT

TAGGTCTAAATCCTTCCTGCCCTCCTGTAAGCTTTCATGGTTCTGAGTGGTATCTGTGAATCCATCCCGGGGGCTTTTATTTACATGGTTTCTTTCCCAT

TAAGAGTGAGAAGGCTAAGTAGAATTCAGATTATAAAAAAGGATTTAAAAAGTAATCCTGAGCTGGGGGCTTTCTCGGAATTTTCAGGGGATGCAGAGTA

AGTTTTCCATTTCCTAATTCCCAGGTATCTATCAGAAAGATCTTTAGGAAAATGTTAAAGGAACAAACAAGTTCTTTGCTTATGTGTTTTCATTTAAATA

CCTAATCTATAATTTTCCTTTAGGAATACTATTGGTTTAGGTTGAGTCCAGTTTTGTGGTGGTATATATCACTTTTCTATAGCTGCTTTAAAATTTTTCC

TAAACTTGGAAGAGCAAGAACAACAACAACAACAACAACAACAACAAATCACTCTTTCCTGTCTGGAAGCCACATATTAAGTTTTTTCTGGAGGCTGTGA

GAATCAATTCCAGGCATTCTCTTAACTTTCAGTGGTTTGTGGTAGTCCTTGGTGTTGCTTGGCTCATAGACCCATCACTCCAGTTTCTGGTTCTAGGGCC

TTGTGGTTTCTTCCTCTCTTCTGTCTCATAAGGAAACCATGTTGTGCATGTGGGGTCTATTTGATTAGATTAAGGAGGATCTCCAGTTCAAGACCCTTAA

CTCATTCCACCTACCAAGATCCTTTCCCCAAATAAAGTCTTGTTCTCACATTATGGGGGTTTGGGCTTATATAACCCGGAGTATGGATATCATCAGAACC

TGAGTAAATGCAGCCCAAAGGCAGGGCCTTTAAAGCCTTGTAATTCTGCTAGAGAGACCTGGTCTCTAGGGTGATGACCAGTAGTCTTCAGAGTTTGAAG

GCAGACCCTTGTCAGTGCTTGATGCTGTTAGTAGGGTCAGTGGGAATGATTGGGAAAGGCAGGTTGGCTATAGTAGGAGAGAGCTGTTGGGCTGCCTGCA

GTGGCTGCATGAGCTTCACGCTTCTTGGATAAACAGAGATGCATAGGTGCATTTCTGACCAGTACTTTATCCTGAAAGGGTCCCAGAAAGCAGGTGTGAC

CCAGGTTACACAGTAGGAAGCTTGAAAACATGGGCTTCATGCACTGGTCAAGACAAATCTGAGGGTGGCACAAGGTAATGGTTGGGACCTAGTACCCTTC

TAGAAGGTGGGAGCCCTTGCCACCGACTTACCCTGCAGTATGGTGTATGATTAACCGTACATCAAAGATTTGAGATTCTACCATCTTTTTGACATGAGAC

ATGCTCTTTTCTTTTGCAGAATTACTTAAGCTAGAACTGGAAAAAGTGGTCGTTCCATTCCCCTCAGGAATTAGTCTACTTGCTTTTGCACAAATTTTAT

GTGGCCTCTGGCAGACAACTTTTAGATCCATACAGCTAGAAGCATGCCCTTTCCAGAAGACCTGTTCTGGAATAGATAGTGCTTCTTATGTATGCTCTCT

TCCTGTTGGCCCATGCCCAAGAGAAAACCAGAGAGCCAGTAAGACAGTACAGAGTGCTTCACCTACTGAAGTAATAAACGATAAGGCAGATTGTAGGTAG

GAATGATATCTAAAAAGGAACAATTGCAGCCCTGTGTGTGACACCCTCAGGCAAGGTAAGGCCTACCTTTTAGTGTTTCCCCTTTCAAGGTGGGAGTTTG

GAGAGATGAACAAGCACTTTGGAAGCATCCCCAGCCCTCTTTACCTGACAACAGTTTGGTCCTCACAGTGACTGCTTCATTGGAGTGCCTCTCCAGTGTT

ATGGCACCATCATCTGTTACCACCCAAGGCTGTGATGAAATAAGATACAACATATCCGATGACACAGGCCTGCATGGCTAGCATCTTGAACATTTTATTA

CATGAACATTCTCTGTACGATGGTATAAAAAGGCCCGAGGATTAAATTATGTATAAAATATGAAATAAAGAAGTAAGACTTTCAAGCATGCACTCTGTCC

TCCCTTGTTGGATGTAGGGGTAGGATTGCCAGTAACAAAGGTTTTCTTTGCTATTTCTATCTCTTTAATTCCCCTGTATTACATAGGAAGTAGCTGTTAC

ACACAGCTCTGAGGTTTCTTCTGCCTATGGCTGAGGAAAGCTCATTATTGACACAACAGAGTGGTGAAAGGGGCCAAGTCAACTAATTTGGGGCTTGAAT

TTCCTGTGGTTGCAGCAACAAAGTACCACACGTTAGGGAGCTTAGGCAACAGATTTCCTCTCCCTGTTAAGGATGGCAGGCATCTGAGAAGTGGGTTCCT

CATAAGGGATAACCCATTCCAGTGCCCCTCTCCAGTGTGTGGCAGGTCCCAGAAATTCTTAGTTTTCTCTAGTTGTACCTGCATCTCTGCCTCTGCCACT

TTTGTCACATGGCCATCTTGTGTTTCCTTTTTATAAGCACACCAGTGTTGTATACAGGTGGGTATTTGGAAACATGGAAGCATTTTGTTCAGTATCTAGT

GACAGTGATGGAAAGAGATGATTTGCAGAGAAGGTCAGAGCAGCATGAGGGTCTTAGGTATGGAGCTGCAGCCAACATTATGGACATGGAAGAGAGGGAT

TGCTGGACTTTTGGTTTCCTGCCTGGGTACCTGGACAATCTATCTACCATTGGGAGGACTAGGTAACAGTGGAAGTTAGTTATGAGAGAAGTTGTTTGAT

GTTCAATTCTGATCTAGCCAGGCTCAGTGTGAGATGTCCTGGGTCCCTTCATCTTGCCTTGACTGTTAGGTGCAGTTTCATATTGAAACTGCAGGCTCTT

TTTTATCCATTGCTACTGGCAACCAGTGTGATCTGGTAAATCTGTTTCCACTTTGCTTAGTGCTCTCCACTGATTTTCTGTTACTTGAGACCTAAACTCC

ATCTTCAGCCTTGTGTTGATCTAATGTCATGTCAACTTCTCTAAAAGCTCAGCCAATTCTACACTGGCCTTCTATTCCTTTCCTCAAACCACTTAGCACT

TTTTTTTTTTAAATTTTTTTAGATTTATTTATTTATTTATTATATGTAAGTACACTGTAGTTGTCTTCAGACACTCCAGAAAAGGAGTCAGATCTTGTTA

CGGATGGTTGTGAGCCACCATGTGGTTGCTGGGATTTGAACTCCAGACCTTTGGAAGAGCAGTAGGGTGCTCTTACCCACTGAGCCATCTCACCAGCCCA

GCACTTCTGTTTCTTAAGGCTGTTGCTCCTGTTGTCTCCTTTGCTGAGAAAGTTCTGTTCCCTAATTTGTACTGTTGACTACTTTTTGTCATCCATATAA

GTGTAAACAAAAGTTCTTTCATCTGATCTCTTCATCCTAAATCATACTACCCTGTTTTAACTCACATTACTACCACTGACCTTTTCTAGTGTTTTTTTCT

TTTCTACCACTAGAGGGAGACAGAAGCCGTATCAATTTAGTCGTATACTCAACACAGGGAAACTGCATTTACTGATGGCTGAGCTTGTCTGAGACGATAT

CAGGATTCCCCTGCCAATATCTTCATGGACGTCACTTGTCACCATAATTGGTGACTTATAGAAGTTATTAATGTACTAGAAATTATAGTACAGAAATCTT

ATTTTAGGACTATAGTACCAATAGCCTTTTTTTGTGGTGCTGGGGATAGAACCCAGGGTCTTTCACATGTAAGCATTCATACCATCACTGAGCTACAATC

CCTGGTTATCAGCTTCTCACTTTATTTACCTTCCCCTGACTTTGACAGCCCTGTCTAGTTTGGAACTTATTATGTAATCCACGATGGCCTTGAATTTACA

GCCATCCTCAGCCTCTCCAGTGCTAGGATTATAAATATATCTGACTAGCTTATTTTTTTCATTTTGTTCAGGTTTTTAATGAGTGTCTTGGTTTCAGATA

TGAAAAACAGAATTTGGAAGAAAGCCAGTTGGGCCAGTCTGTGGTAGAGCATGCACTCAAAGTTGAAGCAAGATGTTAATGAGTTCTAGGCTGGCTTAGG

CTTCATAGCAAGATCCTATCTCATAAAACAAAAAGTTAACTGGTGATTCCCTGGAGGTGAGAGGGGTGAGGAGAGAGTGATAGTTAATGAATACAAAGTT

CTTTGAGGGAAAATGAGAATATTCTGAAATTGGCTATGGCGATACTCATACATTTGTGAATGTGCAAGGAACACTTCAGATGAATGACTTTTGTTGTATA

TGGATTAGGTTGCAATAAAACTGGCATTTAAAATGTTATCTAAGCCCTGCAGTTTTCCAGAACTTTTTGTGACAACGAAGATGATATAAAAAGAGTTGAA

TATTTGCTTTTGTTAAA
Translation
  - UNI35719 - MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQMLRERCEELLHFQ

VSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ QMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGR RIRAVSEQ

VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQLQQAEEALVAKQELIDKL

KEEAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVETPQPPLLPAPA AHHSFHL

ALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Transcript ENSMUST00000114128
Sequence
TGTTTGTTCTTGTTCTCTTTGGGATTAACAAGACATAGAACCTGCTCTCCTTGTTTTGGCTCAGCCTGCAACTGACAGTCTGCCTGGCTTCAAGTCACCC

AAGGGAGGTGAG GAGGAAGAAGTGCTACTGGGTGGTGCTTTAGCACCTGTGATGGTCCAAGTCTGGTCTCCACTCAATGGCTCAGCACAGAGTTCTGAG

ATGTGACACAAGTACATGTATATCAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACCAGCTGAGTGAGATGGTGCAG

CCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTACTCCTG

AGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACGCTGTGAGGAGCTGCTGCATT

TCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCG

GAGTCAGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG CAGATGGCTGAGGACAAGGCCTCTGTGAAAGCTCAGGTGACATC

ATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATTCGAGCAGTTAGTGAGCAGGT

CAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAGGCTGCCTTGCGA

ATGGAGCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACTACGACAGCCACATTAAGAGC

AGCAAG GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAG

GCTGAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAGCTGAGAGGCATGCCCGGGAG

AAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAG GATT

GAGGATATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGGCCTTGTCCAACCAGCGGAGG

AGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACATGTCATGGAGTGCATAGAGT

AGGAGCAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGTCCACACTTAAGGGCTTGCTT

TAGCCCTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTCTGGTGGCTTCTTCCCTCTTC

TCCCATAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGCTTTTCTTCTCTCCAACTGGT

ACCTTTCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAGACATGTGGAA
Translation
  - UNI35719 - MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQMLRERCEELLHFQ

VSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ QMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGR RIRAVSEQ

VRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQLQQAEEALVAKQELIDKL

KEEAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVETPQPPLLPAPA AHHSFHL

ALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Transcript ENSMUST00000114129
Sequence
CTTGTTCTCTTTGGGATTAACAAGACATAGAACCTGCTCTCCTTGTTTTGGCTCAGCCTGCAACTGACAGTCTGCCTGGCTTCAAGTCACCCAAGGGAGG

TGAG GAGGAAGAAGTGCTACTGGGTGGTGCTTTAGCACCTGTGATGGTCCAAGTCTGGTCTCCACTCAATGGCTCAGCACAGAGTTCTGAGATGTGACA

CAAGTACATGTATATCAGGTACTGCTGTGATGATCAGGACACACAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACC

AGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCC

TTCAGAGCAGGGTACTCCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACG

CTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGC

TTGGAGAAGCTTGATCTTCGGAGTCAGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG ATGGCTGAGGACAAGGCCTCTGTG

AAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATTCGA

GCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCG

TGGAGGCTGCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACTACG

ACAGCCACATTAAGAGCAGCAAG GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTG

ATAAGCTGAAAGAGGAGGCTGAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAGCTG

AGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCA

TGAGTCAGCCAG GATTGAGGATATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGGCCT

TGTCCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACATGT

CATGGAGTGCATAGAGTAGGAGCAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGTCCA

CACTTAAGGGCTTGCTTTAGCCCTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTCTGG

TGGCTTCTTCCCTCTTCTCCCATAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGCTTT

TCTTCTCTCCAACTGGTACCTTTCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAGACA

TGTGGAAAGTATTCTGTCCTTTTGTTACTGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCTTAGATGTG

ACATTGGATCCTTGCCCTGGAGGAGGTGGGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAGTGTCTTTT

TCTGGGGCATGTGGGCCCTTTTTAATTCCTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTTCTTGGGCT

TTGTAGAGCTTTTTGATTATCAGTCAGGTTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCC
Translation
  - UNI35719 - MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQMLRERCEELLHFQ

VSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ MAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALEGR RIRAVSEQV

RQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQLQQAEEALVAKQELIDKLK

EEAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVETPQPPLLPAPA AHHSFHLA

LSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
Transcript ENSMUST00000114130
Sequence
ATGCGGTGCCTTGAAAATGGG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACCAGCTGAGTGAGATGGTGCAGCCCAG

TGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTACTCCTGAGACC

CTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACGCTGTGAGGAGCTGCTGCATTTCCAG

GTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCGGAGTC

AGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG CAGATGGCTGAGGACAAGGCCTCTGTGAAAGCTCAGGTGACATCATTGC

TCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATTCGAGCAGTTAGTGAGCAGGTCAGAC

AGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAGGCTGCCTTGCGAATGGA

GCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACTACGACAGCCACATTAAGAGCAGCAA

G GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAGGCTGA

GCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAGCTGAGAGGCATGCCCGGGAGAAGCT

GGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAG GATTGAGGA

TATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGGCCTTGTCCAACCAGCGGAGGAGCCC

TCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACATGTCATGGAGTGCATAGAGTAGGAG

CAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGTCCACACTTAAGGGCTTGCTTTAGCC

CTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTCTGGTGGCTTCTTCCCTCTTCTCCCA

TAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGCTTTTCTTCTCTCCAACTGGTACCTT

TCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAGACATGTGGAAAGTATTCTGTCCTTT

TGTTACTGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCTTAGATGTGACATTGGATCCTTGCCCTGGAG

GAGGTGGGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAGTGTCTTTTTCTGGGGCATGTGGGCCCTTTT

TAATTCCTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTTCTTGGGCTTTGTAGAGCTTTTTGATTATCA

GTCAGGTTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCC
Translation
MRCLENG - UNI35719 - TLSCWMNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAIRQSNQML

RERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ QMAEDKASVKAQVTSLLGELQESQSRLEAATKDRQALE

GR RIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQL   
Transcript ENSMUST00000004330
Sequence
CTTGTTCTCTTTGGGATTAACAAGACATAGAACCTGCTCTCCTTGTTTTGGCTCAGCCTGCAACTGACAGTCTGCCTGGCTTCAAGTCACCCAAGGGAGG

TGAG GAGGAAGAAGTGCTACTGGGTGGTGCTTTAGCACCTGTGATGGTCCAAGTCTGGTCTCCACTCAATGGCTCAGCACAGAGTTCTGAGATGTGACA

CAAGTACATGTATATCAGGTACTGCTGTGATGATCAGGACACACAG - UNI35719 - ACACTGTCCTGTTGGATGAACAAGCACCCCTGGAAGAACC

AGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACCAGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCC

TTCAGAGCAGGGTACTCCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAG ACGCTATCCGGCAGAGCAATCAGATGCTGAGGGAACG

CTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTATGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGC

TTGGAGAAGCTTGATCTTCGGAGTCAGAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAG CAGATGGCTGAGGACAAGGCCTCT

GTGAAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCAAGGATCGGCAAGCTTTAGAGGGAAG GATT

CGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGA

GCGTGGAGGCTGCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAA GCGGAAGCTGGCTCAGTTGCAGGCAGCCTATCACCAGCTCTTCCAAGACT

ACGACAGCCACATTAAGAGCAGCAAG GGCATGCAGCTGGAAGATCTGAGGCAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGA

TTGATAAGCTGAAAGAGGAGGCTGAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAG GCGGATATCTACAAGGCTGACTTCCAAG

CTGAGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTG

CCATGAGTCAGCCAG GATTGAGGATATGAGGAAGCGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAG CTCACCACTCCTTTCATTTGG

CCTTGTCCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCCTGATATGGACACTCTACAGATACA

TGTCATGGAGTGCATAGAGTAGGAGCAGCAGATGCAAGGCCACTTGCAGTACTATGTCCTGATCTGTGTGACTTGTGCTTTCCTGTTTTACCTGCATAGT

CCACACTTAAGGGCTTGCTTTAGCCCTTTGGTCCCCCATTTAGGGTAGACAGCCCCATTCAGGGCTTTTTTTTTTCTGTGTGCCTGATCCAGTTTGCCTC

TGGTGGCTTCTTCCCTCTTCTCCCATAGTCCTAGGGAGTCTAGAATGGAGGCCAGGGGCTCTTAGGGAGCATCCCTTCTCCAAGCAGGTCTGGGTACAGC

TTTTCTTCTCTCCAACTGGTACCTTTCTTGCCGGTGAACTGCAGGCTCTCCTCCCAGGGCATGTGGCACTTGGGTCTATAACATGTGTTACCTCTGGTAG

ACATGTGGAAAGTATTCTGTCCTTTTGTTACTGTAATTAATGGTGTAGTGAAAGTACTTGTACACTGATCTGTGTGTACCTTTAGGACAGATGCTTAGAT

GTGACATTGGATCCTTGCCCTGGAGGAGGTGGGCAGACCTTTGGATTTTTGCCATCTCTAAGATATACCATTCTTTACTAAAGAATTTGCTTAAGTGTCT

TTTTCTGGGGCATGTGGGCCCTTTTTAATTCCTCTGATGTAACTTGGATTTTCATAATTCCTACCCATTTTTCTGTTGGGACATTGCCATTTGTTCTTGG

GCTTTGTAGAGCTTTTTGATTATCAGTCAGGTTGGTTTTGACTATTACAGAAGTGCACCCCTTGTTCC
Translation
 MYIRYCCDDQDTQ - UNI35719 - TLSCWMNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRD DAI

RQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ QMAEDKASVKAQVTSLLGELQESQSRLEAAT

KDRQALEGR RIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEK KRKLAQLQAAYHQLFQDYDSHIKSSK GMQLEDLRQQ

LQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQ ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESAR RIEDMRKRHVET

PQPPLLPAPA AHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE

For any suggestions or comments, please send an email to unitrap@crg.es