Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004263 (Atn1)
Chromosomal location
Chr 6: 124692564 - 124706505 (-)
Description
atrophin 1 Gene [Source:MGI (curated);Acc:Atn1-001]
RefSeq_peptide
NP_031907.2 
UniGene
Mm.333380 
MGI
MGI:104725 
Uniprot/SPTREMBL
O35126 P70200 
Human Ortholog
ENSG00000111676 (ATN1)
Omim 125370 - DENTATORUBRAL-PALLIDOLUYSIAN ATROPHY  140340 -  
UniTrap UNI21857
Vector Insertion
Chr 6: 124699940 - 124706313
Public Clones D099H06 (ggtc) IST13244F3 (tigm)
Private Clones OST315356 (lexicon) OST210003 (lexicon) OST169177 (lexicon) OST57478 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25383
Vector Insertion
Chr 6: 124699618 - 124699764
Public Clones not available
Private Clones OST185999 (lexicon) OST104868 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25757
Vector Insertion
Chr 6: 124699368 - 124699479
Public Clones not available
Private Clones OST167433 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30786
Vector Insertion
Chr 6: 124695656 - 124698008
Public Clones IST15047C11 (tigm) IST10370G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33812
Vector Insertion
Chr 6: 124694737 - 124695880
Public Clones IST12317H5 (tigm) IST14665F12 (tigm) IST14210B1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088357
Sequence
GCCGATCGGGGCTGCGCGGGGAGCCGGGCATGGGGGCCGCCCTCCGGGGGGGCCGGGGCCGCCGCCGCCGCCGCCGCGGCAGCGACTGAAGCCGCGCTGT

AAGGAGGGGCGGGGAGTGGCCGCCGCCGTCCCCGGGAGGCGCCGGAGCCCGACCGCACTCGCAGCCAGCCAGCCGTCCCGAGCTGCTCGCAG - UNI21

857 - ATTCACTGAAAACACCCTGCAAGTACCACGTGCCTACAACTGCTGCCAGCTTCCCAGGCCACAGCTGTGGGGAGCTTGGGGTACAGCAGACTCG

TTTCTGTATTCAGCTGCCCAGGCAGAGGAGAATGGGGTCTCCACAGCCTGAAGAATGAAGACACGACAGAATAAAGACTCG - UNI25383 - ATGTC

AATGAGGAGTGGACGGAAGAAAGAGGCCCCCGGGCCCCGGGAAGAGCTGAGATCAAGGGGCCGGGCCTCCCCTGGAGGGGTCAGCACATCCAGCAGTGAT

GGCAAAGCTGAGAAGTCCAGGCAGACAGCCAAG - UNI25757 - AAGGCCCGGATAGAGGAGCCCTCTGCCCCAAAGGCCAGCAAGCAGGGCCGGAG

CGAGGAGATCTCAGAGAGTGAGAGCGAGGAGACCAGTGCGCCCAAAAAGACCAAAACCGAG - UNI30786 - CAGGAGCTCCCTCGCCCGCAGTCTC

CCTCGGATCTGGACAGCTTGGATGGGCGCAGCATTAACGATGACGGCAGCAGCGACCCTAGAGATATAGACCAGGACAACCGAAGCACATCCCCCAGCAT

CTACAGCCCGGGCAGCGTGGAAAATGACTCGGACTCATCCTCTGGCCTGTCCCAGGGCCCCGCCCGCCCCTACCACCCACCTCCACTCTTCCCTCCTTCC

CCTCCACCACCAGACAGCACTCCCCGACAGCCAGAGTCTGGCTTTGAACCTCATCCTTCTGTGCCGCCTACTGGATATCATGCTCCGATGGAGCCCCCCA

CATCGAGATTATTCCAGGGCCCACCACCTGGAGCTCCTCCCACACACCCACAGCTCTACCCTGGGAATGCTAGTGGAGGTGTTTTATCTGGACCCCCCAT

GGGTCCCAAAGGGGGAGCCGCTGCCTCCTCAGTGGGTGCCCCTAGCGGAGGCAAGCAACACCCCCCACCCACTACCCCAATTCCAATATCAAGTTCTGGG

GCCAGTGGTGCTCCTCCAGCAAAGCCACCCAGTGCTCCAGTGGGTGGTGGGAGCTTACCTTCTGCACCACCACCAGCTTCTTTCCCCCATGTGACACCAA

ACCTGCCTCCTCCACCTGCCCTGAGACCCCTCAACAATGCCTCAGCCTCTCCTCCTGGCATGGGGGCTCAGCCAATCCCTGGGCATCTGCCCTCTCCCCA

TGCCATGGGGCAGGGCATGAGTGGACTTCCTCCTGGCCCAGAGAAGGGTCCAACCCTGGCCCCTTCTCCCCACCCTTTGCCCCCAGCTTCTTCCTCTGCC

CCTGGGCCTCCAATGCGATATCCATATTCATCCTCCAGTAGCTCTGCCGCAGCCTCTTCTAGTTCCTCCTCCTCCTCTGCCTCCCAGTACCCTGCTTCCC

AGGCCCTGCCCAGTTATCCTCATTCCTTCCCCCCACCAACTAGTATGTCTGTCTCTAATCAGCCACCCAAGTACACCCAGCCTTCTCTCCCATCCCAAGC

TGTGTGGAGCCAGGGTCCACCTCCTCCTCCTCCCTATGGCCGCCTCTTGGCCAACAACAACACCCATCCAGGCCCTTTCCCTCCTACTGGGGGTCAATCT

ACAGCCCACCCAGCAGCCCCTACACATCACCATCACCAGCAGCAGCCACAGCAACAACATCATCATGGAAACTCTGGGCCCCCTCCACCCGGAGCGTATC

CTCACCCTCTAGAGAGCAGTAACTCCCATCATGCACACCCTTACAACATGTCACCCTCCCTGGGGTCTTTAAGGCCCTACCCCCCAGGGCCAGCACACCT

GCCTCCACCTCATGGCCAGGTGTCCTATAACCAAGCAGGTCCCAATGGTCCCCCAGTTTCTTCTTCCAACTCTTCCGGGTCTTCCTCTCAAGCCTCCTAT

TCATGTTCACACCCCTCTTCATCCCAGGGCCCCCAAGGAGCATCCTACCCCTTCCCACCAGTCCCTCCAGTCACCACCTCCTCAGCTACCCTTTCCACTG

TCATCGCCACCGTGGCTTCCTCGCCAGCAGGCTACAAAACAGCTTCGCCACCTGGGCCCCCTCAGTACAGCAAGAGAGCCCCATCCCCAGGGTCCTACAA

GACAGCCACCCCGCCTGGATACAAACCGGGGTCACCACCCTCCTTCAGAACAGGGACCCCACCCGGCTATCGAGGCACCTCTCCGCCAGCAGGCCCAGGG

ACCTTCAAACCAGGTTCACCGACCGTGGGGCCGGGGCCCCTGCCACCCGCGGGGCCTTCAAGTTTGTCATCTCTGCCTCCGCCACCTGCGGCCCCGACTA

CAGGGCCGCCCCTGACCGCCACGCAGATCAAACAGGAGCCGGCGGAAGAGTATGAACCTCCCGAGAGTCCGGTGCCTCCGGCCCGCAGCCCCTCGCCCCC

TCCCAAGGTGGTGGACGTGCCCAGCCATGCCAGCCAGTCAGCCAG - UNI30786 - - UNI33812 - GTTCAATAAGCACTTGGACCGCGGCTTC

AACTCGTGCGCGCGCAGCGACCTGTACTTCGTGCCGCTGGAGGGCTCCAAGCTGGCCAAGAAGCGCGCGGACCTGGTGGAGAAAGTGCGGCGCGAGGCCG

AGCAGCGCGCGCGCGAGGAGAAAGAGCGCGAGCGCGAGCGGGAACGCGAAAAGGAGCGCGAGCGCGAGAAAGAGCGCGAGCTGGAGCGCAGTGTG - UN

I30786 - - UNI33812 - AAACTGGCCCAGGAGGGCCGTGCTCCAGTGGAGTGCCCATCTCTGGGTCCAGTGCCCCATCGGCCTCCCTTTGAGCCT

GGCAGCGCTGTGGCTACAGTGCCCCCTTACCTGGGTCCTGATACTCCGGCCTTGCGCACTCTCAGTGAATACGCCCGACCTCATGTCATGTCTCCTGGCA

ATCGCAACCACCCATTCTATGTGCCCTTGGGGGCAGTGGACCCGGGGCTTCTGGGTTACAATGTCCCAGCCCTGTACAGCAGCGACCCAGCTGCCCGAGA

ACGGGAGCGGGAAGCCCGTGAACGTGACCTCCGTGACCGGCTCAAGCCTGGCTTTGAGGTGAAACCTAGTGAGCTGGAACCCCTACATGGGGTTCCCGGG

CCAGGCCTGGATCCCTTCCCCCGACACGGGGGCCTGGCTCTACAGCCCGGGCCACCTGGCCTGCATCCTTTCCCTTTTCATCCGAGCCTGGGGCCCCTGG

AACGAGAACGGCTAGCGCTGGCAGCTGGGCCAGCCTTGCGTCCTGACATGTCTTATGCTGAGCGGTTGGCAGCTGAAAGGCAGCATGCAGAAAGGGTGGC

AGCCCTGGGCAATGATCCACTAGCCCGGCTGCAGATGCTCAACGTGACTCCCCATCACCACCAGCACTCCCACATCCACTCTCACCTTCACCTGCACCAG

CAGGATGCTATCCACGCAG - UNI33812 - CCTCTGCCTCGGTGCACCCTCTCATTGACCCCCTGGCCTCAGGGTCTCACCTTACCCGGATCCCCTA

CCCAGCTGGGACCCTCCCCAACCCCCTTCTTCCTCACCCTCTGCACGAGAACGAAGTTCTTCGTCACCAGCTTTTTG CTGCCCCTTACCGGGACCTGCC

GGCCTCCCTTTCTGCTCCAATGTCAGCGGCTCATCAGCTGCAGGCCATGCACGCGCAGTCAGCTGAGCTGCAGCGCTTGGCGCTGGAACAGCAGCAGTGG

CTACATGCTCATCACCCATTGCACAGCGTGCCACTACCTGCCCAGGAAGACTACTACAG TCACCTGAAGAAGGAGAGTGACAAGCCGCTGTAGAGCTGC

GATCCAGACAGCACCCACTGCTCCTTCATCCAGACCTTGGAGGACCACCCCAACCTTTTGACCCCACCCCACCCCCAGCCGAGGAGAGGGTGCTGCCCGC

TTGCAGAGCTCCTGCAGCTGGGTAGAGGGAGGGAGGGAAGAAGGGACAGACAAGGTCAGGGCCCGGGGTTGTGTGCAGAGGTGGGAAGTGGCAAGGGTGG

GGGCAGAAAGTGCACAGTATCTTGGACCAGGTCCCTCCTCCTATCCCCTGCTTTTCTTCTCCTCTATGCCGAATCCTTGGTGGCCACTGCCCCTCCCCTA

ACCCATTGGTGTGATTTTTTTCATCTGTTAGATGTGGCTGTTTTGCGTAGCATTGTGTGCTGCCCCGCCCCATCCCTGTGTGTGCACCCCCTCCCTCGGC

GATATGTGCCCTTACCCGTCCCACATTAATAATTTATATATATAAATATCTATATGATGCTCTTTAAAAAACATCCTGACCAAAACCAACCAAACAAAAA

CATCCTCACAGTTCCCCAGG
Translation
 - UNI21857 - MKTRQNKDS - UNI25383 - MSMRSGRKKEAPGPREELRSRGRASPGGVSTSSSDGKAEKSRQTAK - UNI25757 - KAR

IEEPSAPKASKQGRSEEISESESEETSAPKKTKTE - UNI30786 - QELPRPQSPSDLDSLDGRSINDDGSSDPRDIDQDNRSTSPSIYSPGSVEND

SDSSSGLSQGPARPYHPPPLFPPSPPPPDSTPRQPESGFEPHPSVPPTGYHAPMEPPTSRLFQGPPPGAPPTHPQLYPGNASGGVLSGPPMGPKGGAAAS

SVGAPSGGKQHPPPTTPIPISSSGASGAPPAKPPSAPVGGGSLPSAPPPASFPHVTPNLPPPPALRPLNNASASPPGMGAQPIPGHLPSPHAMGQGMSGL

PPGPEKGPTLAPSPHPLPPASSSAPGPPMRYPYSSSSSSAAASSSSSSSSASQYPASQALPSYPHSFPPPTSMSVSNQPPKYTQPSLPSQAVWSQGPPPP

PPYGRLLANNNTHPGPFPPTGGQSTAHPAAPTHHHHQQQPQQQHHHGNSGPPPPGAYPHPLESSNSHHAHPYNMSPSLGSLRPYPPGPAHLPPPHGQVSY

NQAGPNGPPVSSSNSSGSSSQASYSCSHPSSSQGPQGASYPFPPVPPVTTSSATLSTVIATVASSPAGYKTASPPGPPQYSKRAPSPGSYKTATPPGYKP

GSPPSFRTGTPPGYRGTSPPAGPGTFKPGSPTVGPGPLPPAGPSSLSSLPPPPAAPTTGPPLTATQIKQEPAEEYEPPESPVPPARSPSPPPKVVDVPSH

ASQSAR - UNI30786 - - UNI33812 - RFNKHLDRGFNSCARSDLYFVPLEGSKLAKKRADLVEKVRREAEQRAREEKEREREREREKEREREK

ERELERSV - UNI30786 - - UNI33812 - KLAQEGRAPVECPSLGPVPHRPPFEPGSAVATVPPYLGPDTPALRTLSEYARPHVMSPGNRNHPF

YVPLGAVDPGLLGYNVPALYSSDPAAREREREARERDLRDRLKPGFEVKPSELEPLHGVPGPGLDPFPRHGGLALQPGPPGLHPFPFHPSLGPLERERLA

LAAGPALRPDMSYAERLAAERQHAERVAALGNDPLARLQMLNVTPHHHQHSHIHSHLHLHQQDAIHAA - UNI33812 - ASASVHPLIDPLASGSHL

TRIPYPAGTLPNPLLPHPLHENEVLRHQLFA AAPYRDLPASLSAPMSAAHQLQAMHAQSAELQRLALEQQQWLHAHHPLHSVPLPAQEDYYS SHLKKE

SDKPL

For any suggestions or comments, please send an email to unitrap@crg.es