Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004266 (Ptpn6)
Chromosomal location
Chr 6: 124670735 - 124683584 (-)
Description
protein tyrosine phosphatase, non-receptor type 6 Gene [Source:MGI Symbol;Acc:MGI:96055]
RefSeq_dna
NM_013545 
RefSeq_peptide
NP_038573.2 NP_001071173.1 
MGI
MGI:96055 
Uniprot/SWISSPROT
P29351 
Uniprot/SPTREMBL
Q3TE70 Q3UB72 Q3UCJ0 
Human Ortholog
ENSG00000111679 (PTPN6)
Omim not available
UniTrap UNI31988
Vector Insertion
Chr 6: 124682963 - 124683585
Public Clones IST14172B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31082
Vector Insertion
Chr 6: 124670734 - 124671241
Public Clones IST14374C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112484
Sequence
CCAGTAGAGTGGTAGCCCGGGGAGCAGGACTGCAGGTTGGCTTTGGAGGCCTGGGCTCTGAGAGCCTTGCCTGAGGCTCATCTCTAGAGTTTGTACGTGC

CTGCCCAGACAAACTGTTCCCTCCACATTTTCTGCAGCCAATTCAGTGAGAACCCCAGGATGGTGAG - UNI31988 - GTGGTTTCACCGGGACCTC

AGCGGGCCTGATGCAGAGACCCTGCTGAAGGGCCGGGGAGTCCCTGGGAGCTTCCTGGCTCGGCCCAGCCGCAAGAACCAGGGTGACTTCTCCCTCTCAG

TCAG GGTGGATGATCAGGTGACTCATATTCGGATCCAGAACTCAGGGGACTTCTATGACCTGTACGGAGGGGAGAAGTTTGCGACGCTGACAGAGCTGG

TCGAGTATTACACGCAGCAGCAGGGCATCCTGCAGGACCGAGATGGCACCATCATCCACCTTAAGTACCCACTGAACTGCTCGGACCCCACCAGTGAGAG

 GTGGTACCACGGCCACATATCTGGAGGGCAGGCGGAGTCACTGCTGCAGGCCAAGGGCGAGCCCTGGACATTTCTTGTGCGTGAGAGTCTCAGCCAACC

TGGTGATTTTGTGCTCTCTGTGCTCAATGACCAGCCCAAGGCTGGCCCAGGTTCCCCGCTCAGGGTCACTCATATCAAGGTTATGTGTGAG GGTGGACG

CTATACTGTGGGTGGCTCAGAGACGTTTGACAGCCTCACAGACCTGGTGGAGCACTTCAAGAAGACAGGGATTGAGGAGGCCTCGGGTGCCTTTGTCTAC

CTGCGGCAG CCTTACTACGCTACTCGGGTAAACGCAGCTGACATTGAGAATCGGGTCTTGGAACTGAACAAGAAGCAGGAGTCGGAGGACACAGCCAAG

GCTGGCTTCTGGGAGGAGTTTGAG AGTCTACAAAAGCAGGAGGTAAAGAATCTACACCAACGTCTGGAAGGGCAGCGGCCAGAGAACAAGAGCAAGAAC

CGCTACAAGAACATTCTTCCCT TTGACCACAGCCGAGTGATCCTGCAGGGACGTGACAGTAACATCCCAGGCTCTGACTACATCAATGCCAACTACGTG

AAG AACCAGCTGCTAGGTCCAGATGAGAACTCTAAGACCTACATCGCCAGCCAGGGCTGTCTGGATGCCACAGTCAATGACTTCTGGCAGATGGCTTGG

CAGGAGAACACTCGTGTCATCGTCATGACTACCAGAGAGGTGGAGAAAGGCCGG AACAAATGTGTCCCATACTGGCCCGAGGTGGGCACTCAGCGTGTC

TATGGTCTCTACTCTGTGACCAACAGTAGGGAGCATGACACAGCAGAATACAAACTGCGAACATTACAGATCTCCCCACTAGACAAT GGGGACCTGGTT

CGGGAGATATGGCACTACCAGTACCTGAGCTGGCCTGACCATGGGGTTCCCAGTGAGCCTGGGGGTGTCCTCAGCTTTCTGGATCAGATCAACCAGCGAC

AGGAAAGTTTGCCTCATGCAGGGCCCATCATTGTGCATTGCAG CGCTGGCATCGGCCGCACGGGCACCATCATCGTCATTGATATGCTTATGGAAAGCA

TCTCCACCAAGG GGCTAGACTGTGACATTGATATCCAGAAGACCATCCAGATGGTACGAGCACAGCGCTCCGGCATGGTGCAGACCGAGGCCCAGTACA

AGTTTATTTACGTGGCCATTGCCCAGTTCATCGAAACGACCAAGAAGAAACTGGAGATCATACAA TCCCAGAAGGGCCAGGAGTCGGAGTATGGGAATA

TCACGTACCCTCCCGCTGTGAGGAGTGCCCACGCCAAAGCCTCGCGTACTTCCTCCAA - UNI31082 - GCACAAGGAGGAGGTGTACGAAAACGTG

CATAGCAAGAGCAAGAAGGAAGAGAAAGTAAAGAAGCAGCGGTCGGCAGACAAGGAGAAGAACAAAGGTTCTCTCAAGAGGAAGTGATCTGGGCATTCGT

CTGCAGGTGGCCATG - UNI31082 - CATCAGCCTTGATCCCTGCAGAGGCTTCCACCCGATAGACTGAGACCTGTGGCCCTCACCAGACCCTAGGA

CCACCCCCATCTTCTTGTAATTTAAGTGACTGTGGTCATCTGAATCTGTATATAGCCCGGCAAGTCCCCAGGGAGAGCCGGGCCCTTCTATTCTTGTAAA

TAAATTCCCTGGACCACTGTG
Translation
MVR - UNI31988 - RWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVR RVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQ

GILQDRDGTIIHLKYPLNCSDPTSER RWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCE GGRYTVGG

SETFDSLTDLVEHFKKTGIEEASGAFVYLRQ PYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFE SLQKQEVKNLHQRLEGQRPENKSKNRYKN

ILPF FDHSRVILQGRDSNIPGSDYINANYVK NQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGR NKCVPYWPEVGTQRVY

GLYSVTNSREHDTAEYKLRTLQISPLDN GDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCS SAGIGRTGTIIVIDMLME

SISTKG GLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQ SQKGQESEYGNITYPPAVRSAHAKASRTSSK - UNI3108

2 - KHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK - UNI31082 - 
Transcript ENSMUST00000004377
Sequence
TTGTCTGTGAA - UNI31988 - GTGGTTTCACCGGGACCTCAGCGGGCCTGATGCAGAGACCCTGCTGAAGGGCCGGGGAGTCCCTGGGAGCTTCCT

GGCTCGGCCCAGCCGCAAGAACCAGGGTGACTTCTCCCTCTCAGTCAG GGTGGATGATCAGGTGACTCATATTCGGATCCAGAACTCAGGGGACTTCTA

TGACCTGTACGGAGGGGAGAAGTTTGCGACGCTGACAGAGCTGGTCGAGTATTACACGCAGCAGCAGGGCATCCTGCAGGACCGAGATGGCACCATCATC

CACCTTAAGTACCCACTGAACTGCTCGGACCCCACCAGTGAGAG GTGGTACCACGGCCACATATCTGGAGGGCAGGCGGAGTCACTGCTGCAGGCCAAG

GGCGAGCCCTGGACATTTCTTGTGCGTGAGAGTCTCAGCCAACCTGGTGATTTTGTGCTCTCTGTGCTCAATGACCAGCCCAAGGCTGGCCCAGGTTCCC

CGCTCAGGGTCACTCATATCAAGGTTATGTGTGAG GGTGGACGCTATACTGTGGGTGGCTCAGAGACGTTTGACAGCCTCACAGACCTGGTGGAGCACT

TCAAGAAGACAGGGATTGAGGAGGCCTCGGGTGCCTTTGTCTACCTGCGGCAG CCTTACTACGCTACTCGGGTAAACGCAGCTGACATTGAGAATCGGG

TCTTGGAACTGAACAAGAAGCAGGAGTCGGAGGACACAGCCAAGGCTGGCTTCTGGGAGGAGTTTGAG AGTCTACAAAAGCAGGAGGTAAAGAATCTAC

ACCAACGTCTGGAAGGGCAGCGGCCAGAGAACAAGAGCAAGAACCGCTACAAGAACATTCTTCCCT TTGACCACAGCCGAGTGATCCTGCAGGGACGTG

ACAGTAACATCCCAGGCTCTGACTACATCAATGCCAACTACGTGAAG AACCAGCTGCTAGGTCCAGATGAGAACTCTAAGACCTACATCGCCAGCCAGG

GCTGTCTGGATGCCACAGTCAATGACTTCTGGCAGATGGCTTGGCAGGAGAACACTCGTGTCATCGTCATGACTACCAGAGAGGTGGAGAAAGGCCGG A

ACAAATGTGTCCCATACTGGCCCGAGGTGGGCACTCAGCGTGTCTATGGTCTCTACTCTGTGACCAACAGTAGGGAGCATGACACAGCAGAATACAAACT

GCGAACATTACAGATCTCCCCACTAGACAAT GGGGACCTGGTTCGGGAGATATGGCACTACCAGTACCTGAGCTGGCCTGACCATGGGGTTCCCAGTGA

GCCTGGGGGTGTCCTCAGCTTTCTGGATCAGATCAACCAGCGACAGGAAAGTTTGCCTCATGCAGGGCCCATCATTGTGCATTGCAG CGCTGGCATCGG

CCGCACGGGCACCATCATCGTCATTGATATGCTTATGGAAAGCATCTCCACCAAGG GGCTAGACTGTGACATTGATATCCAGAAGACCATCCAGATGGT

ACGAGCACAGCGCTCCGGCATGGTGCAGACCGAGGCCCAGTACAAGTTTATTTACGTGGCCATTGCCCAGTTCATCGAAACGACCAAGAAGAAACTGGAG

ATCATACAA TCCCAGAAGGGCCAGGAGTCGGAGTATGGGAATATCACGTACCCTCCCGCTGTGAGGAGTGCCCACGCCAAAGCCTCGCGTACTTCCTCC

AA - UNI31082 - GCACAAGGAGGAGGTGTACGAAAACGTGCATAGCAAGAGCAAGAAGGAAGAGAAAGTAAAGAAGCAGCGGTCGGCAGACAAGGA

GAAGAACAAAGGTTCTCTCAAGAGGAAGTGATCTGGGCATTCGTCTGCAGGTGGCCATG - UNI31082 - CATCAGCCTTGATCCCTGCAGAGGCTT

CCACCCGATAGACTGAGACCTGTGGCCCTCACCAGACCCTAGGACCACCCCCATCTTCTTGTAATTTAAGTGACTGTGGTCATCTGAATCTGTATATAGC

CCGGCAAGTCCCCAGGGAGAGCCGGGCCCTTCTATTCTTGTAAATAAATTCCCTGGACCACTGTG
Translation
LSVK - UNI31988 - KWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVR RVDDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQ

QGILQDRDGTIIHLKYPLNCSDPTSER RWYHGHISGGQAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCE GGRYTVG

GSETFDSLTDLVEHFKKTGIEEASGAFVYLRQ PYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFE SLQKQEVKNLHQRLEGQRPENKSKNRYK

NILPF FDHSRVILQGRDSNIPGSDYINANYVK NQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGR NKCVPYWPEVGTQRV

YGLYSVTNSREHDTAEYKLRTLQISPLDN GDLVREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCS SAGIGRTGTIIVIDMLM

ESISTKG GLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQ SQKGQESEYGNITYPPAVRSAHAKASRTSSK - UNI310

82 - KHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK - UNI31082 - 

For any suggestions or comments, please send an email to unitrap@crg.es