Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004347 (Pde1c)
Chromosomal location
Chr 6: 56022200 - 56312305 (-)
Description
phosphodiesterase 1C Gene [Source:MGI Symbol;Acc:MGI:108413]
Human Ortholog
not available
Omim not available
UniTrap UNI38424
Vector Insertion
Chr 6: 56131677 - 56295147
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101372
Sequence
GGCGCAGGGCGCAGGGCGGAGCTGGGCAGGGGTCTGAGCACCCCGCGGCTCACCCTGCTGCTCAGGCTCATCCTACTCCACCCAGCTCCTCACTTTCTCC

CCTCTTTTTACCACTCAGTTCTCCTCTTGCCTCCAAATCCTCTGGGGAGCCGCCGGTAGCTTCTTTGGCTTTGTTTGAAGGGAAAAAGAACAGGAACAGA

GTCGAGGCGCTTTCTCCCGGACACAGTCCTTATCCCTGTCCCTGGCAGTAGTAAGCATCATGGCTGGTTTCCACAGCTGCCTCCAGCGCGCACCTGGGGC

CGGAGTCCCCTGTGATCCTTGCAGGCTCTGAGCCATCTCTGGGGACGCTGCAGGGGAAGTGACAAAGTGACTGAAAGACTCACTGGGCTGGACCCAGCAA

GGAGAGGAGGCTGGGAAGGGACTACACAAACTCTCTCCACCTCACCCTCAGTGAGAACCTGCAGCTATGGAGTCTCCAACCAAGGAAATTGAAGAATTCG

AGAGCAACTCTCTGAAACACCTGCAACCTGAGCAGATCGAGAAAATCTGGCTTCGGCTCCGCGGGCT - UNI38424 - GAGGAAATATAAGAAAACG

TCCCAGAG - UNI38424 - GTTACGGTCTTTGGTCAAGCAATTAGAACGAGGAGAGGCCTCTGTGGTAGACCTTAAGAAGAATCTGGAATATGCAGC

CACAGTGCTTGAATCTGTATATATTGATGAAACAAG - UNI38424 - GCGACTGCTGGATACAGAGGATGAGCTTAGTGACATTCAATCAGATGCTG

TGCCTTCAGAAGTTCGGGATTGGCTGGCCTCCACCTTCACACGGCAGATGGGGATGATGCTTAGGAGAAGTGATGAGAAGCCCAGGTTCAAGAGCATCGT

CCATGCGGTGCAAGCTGGGATATTTGTGGAAAG AATGTACAGACGGACATCAAACATGGTTGGGCTGAGCTATCCACCGGCTGTAATCGATGCATTGAA

G GATGTGGATACGTGGTCCTTCGATGTCTTTTCCCTCAATGAGGCCAGTGGAGATCATGCACTGAAGTTCATTTTCTATGAATTACTCACACGTTATGA

CCTGATCAGCCGTTTTAAG ATACCGATTTCTGCACTTGTCTCATTTGTGGAGGCCCTCGAAGTGGGTTACAGCAAGCACAAAAATCCTTACCATAACCT

GATGCATGCAGCTGACGTCACACAGACTGTGCATTACCTCCTTTATAAGACAGGAGTAGCA AACTGGCTGACAGAGCTGGAGATCTTTGCAATAATCTT

TTCGGCTGCCATCCATGACTATGAACATACTGGAACTACAAACAATTTCCACATTCAGACTCG GTCAGATCCAGCTATCCTGTACAATGACAGATCTGT

CCTGGAGAACCACCACCTGAGTGCAGCCTACCGCCTTCTGCAGGAAGACGAAGAGATGAATATTCTGGTTAACCTCTCAAAGGATGACTGGAG GGAGTT

TCGAACTTTGGTTATTGAGATGGTAATGGCCACAGATATGTCCTGTCATTTCCAGCAAATCAAAGCCATGAAGACAGCCCTGCAGCAACCAGAAGC AAT

TGAGAAGCCGAAAGCCTTATCCCTCATGTTACACACAGCAGACATCAGTCATCCTGCGAAAGCATGGGACCTGCACCACCGCTGGACCATGTCTCTCCTG

GAGGAGTTCTTTAGACAG GGTGACAGAGAAGCAGAGCTGGGGCTGCCATTTTCTCCTCTTTGTGACAGAAAGTCAACCATGGTTGCTCAGTCACAAGTG

G GTTTTATTGACTTCATTGTGGAGCCCACCTTCACTGTGCTCACGGACATGACCGAGAAGATTGTGAGTCCATTAATTGACGAAAGCTCCCAGACTGGT

GGGACAGGGCAGAGGAGATCAAG TTTGAACAGCATCAACTCATCAGATGCAAAGCGATCCGGTGTCAAGAGTTCTGGGTCAGATGGAAGTGCTCCCATC

AACAATTCTGTCATTCCTGTTGACTATAAGAGTTTTAAAGCCACTTGGACTGAGGTGGTGCAGATCAATCGGGAGCGGTGGCGAGCCAAGGTACCCAAAG

 AAGAAAAAGCCAAGAAGGAAGCTGAAGAGAAGGCTCGCCTGGCTGCTGAGGAAAAGCAAAAGGAAATGGAAGCCAAAAGCCAAGCTGAACAAGGCACAA

CCAGCAAAGGCGAGAAAAAGACATCAGGAGAAGCCAAAAGTCAAGTCAATGGAACACGCAAGGGTGATAACCCTCGTGGGAAGAACTCCAAAGGAGAAAA

GGCAGGCGAAAAGCAGCAGAACG GTGACTTGAAAGACGGTAAAAATAAGGCAGACAAGAAGGATCACTCCAACACCGGAAATGAGTCAAAGAAAACAGA

TG GCCCCGATGAG
Translation
MESPTKEIEEFESNSLKHLQPEQIEKIWLRLRGL - UNI38424 - LRKYKKTSQR - UNI38424 - RLRSLVKQLERGEASVVDLKKNLEYAAT

VLESVYIDETR - UNI38424 - RRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVER RMYRRTSNMVGL

SYPPAVIDALK DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFK IPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVA 

NWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTR RSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWR REFRTLVIEMVMATDMSCHF

QQIKAMKTALQQPEA AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQ GDREAELGLPFSPLCDRKSTMVAQSQVG GFIDFIVEPTFTV

LTDMTEKIVSPLIDESSQTGGTGQRRSS SLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKE EEKAKKEAEE

KARLAAEEKQKEMEAKSQAEQGTTSKGEKKTSGEAKSQVNGTRKGDNPRGKNSKGEKAGEKQQNG GDLKDGKNKADKKDHSNTGNESKKTDG GPDE
Transcript ENSMUST00000114327
Sequence
AAATCCTCTGGGGAGCCGCCGGTAGCTTCTTTGGCTTTGTTTGAAGGGAAAAAGAACAGGAACAGAGTCGAGGCGCTTTCTCCCGGACACAGTCCTTATC

CCTGTCCCTGGCAGTAGTAAGCATCATGGCTGGTTTCCACAGCTGCCTCCAGCGCGCACCTGGGGCCGGAGTCCCCTGTGATCCTTGCAGGCTCTGAGCC

ATCTCTGGGGACGCTGCAGGGGAAGTGACAAAGTGACTGAAAGACTCACTGGGCTGGACCCAGCAAGGAGAGGAGGCTGGGAAGGGACTACACAAACTCT

CTCCACCTCACCCTCAGTGAGAACCTGCAGCTATGGAGTCTCCAACCAAGGAAATTGAAGAATTCGAGAGCAACTCTCTGAAACACCTGCAACCTGAGCA

GATCGAGAAAATCTGGCTTCGGCTCCGCGGGCT - UNI38424 - GAGGAAATATAAGAAAACGTCCCAGAG - UNI38424 - GTTACGGTCTTT

GGTCAAGCAATTAGAACGAGGAGAGGCCTCTGTGGTAGACCTTAAGAAGAATCTGGAATATGCAGCCACAGTGCTTGAATCTGTATATATTGATGAAACA

AG - UNI38424 - GCGACTGCTGGATACAGAGGATGAGCTTAGTGACATTCAATCAGATGCTGTGCCTTCAGAAGTTCGGGATTGGCTGGCCTCCAC

CTTCACACGGCAGATGGGGATGATGCTTAGGAGAAGTGATGAGAAGCCCAGGTTCAAGAGCATCGTCCATGCGGTGCAAGCTGGGATATTTGTGGAAAG 

AATGTACAGACGGACATCAAACATGGTTGGGCTGAGCTATCCACCGGCTGTAATCGATGCATTGAAG GATGTGGATACGTGGTCCTTCGATGTCTTTTC

CCTCAATGAGGCCAGTGGAGATCATGCACTGAAGTTCATTTTCTATGAATTACTCACACGTTATGACCTGATCAGCCGTTTTAAG ATACCGATTTCTGC

ACTTGTCTCATTTGTGGAGGCCCTCGAAGTGGGTTACAGCAAGCACAAAAATCCTTACCATAACCTGATGCATGCAGCTGACGTCACACAGACTGTGCAT

TACCTCCTTTATAAGACAGGAGTAGCA AACTGGCTGACAGAGCTGGAGATCTTTGCAATAATCTTTTCGGCTGCCATCCATGACTATGAACATACTGGA

ACTACAAACAATTTCCACATTCAGACTCG GTCAGATCCAGCTATCCTGTACAATGACAGATCTGTCCTGGAGAACCACCACCTGAGTGCAGCCTACCGC

CTTCTGCAGGAAGACGAAGAGATGAATATTCTGGTTAACCTCTCAAAGGATGACTGGAG GGAGTTTCGAACTTTGGTTATTGAGATGGTAATGGCCACA

GATATGTCCTGTCATTTCCAGCAAATCAAAGCCATGAAGACAGCCCTGCAGCAACCAGAAGC AATTGAGAAGCCGAAAGCCTTATCCCTCATGTTACAC

ACAGCAGACATCAGTCATCCTGCGAAAGCATGGGACCTGCACCACCGCTGGACCATGTCTCTCCTGGAGGAGTTCTTTAGACAG GGTGACAGAGAAGCA

GAGCTGGGGCTGCCATTTTCTCCTCTTTGTGACAGAAAGTCAACCATGGTTGCTCAGTCACAAGTGG GTTTTATTGACTTCATTGTGGAGCCCACCTTC

ACTGTGCTCACGGACATGACCGAGAAGATTGTGAGTCCATTAATTGACGAAAGCTCCCAGACTGGTGGGACAGGGCAGAGGAGATCAAG TTTGAACAGC

ATCAACTCATCAGATGCAAAGCGATCCGGTGTCAAGAGTTCTGGGTCAGATGGAAGTGCTCCCATCAACAATTCTGTCATTCCTGTTGACTATAAGAGTT

TTAAAGCCACTTGGACTGAGGTGGTGCAGATCAATCGGGAGCGGTGGCGAGCCAAGGTACCCAAAG AAGAAAAAGCCAAGAAGGAAGCTGAAGAGAAGG

CTCGCCTGGCTGCTGAGGAAAAGCAAAAGGAAATGGAAGCCAAAAGCCAAGCTGAACAAGGCACAACCAGCAAAGGCGAGAAAAAGACATCAGGAGAAGC

CAAAAGTCAAGTCAATGGAACACGCAAGGGTGATAACCCTCGTGGGAAGAACTCCAAAGGAGAAAAGGCAGGCGAAAAGCAGCAGAACG GTGACTTGAA

AGACGGTAAAAATAAGGCAGACAAGAAGGATCACTCCAACACCGGAAATGAGTCAAAGAAAACAGATG GTACAAAGAAGCGTTCTCATGGCTCACCTGC

TCCGAGCACTAGTTCCACAAGTCGCATTACCTTGCCAG GAGACTACGGATAAAACATCATCCAGAAACTTCCTTGGAAGAAACCTGACCATCCCCAAGG

TCTGAAGACAATGTGGAAAATTTATATTTTTTTCCCCAAACAAAATCTACATGTATTGTAAGTTATTGAGTATTAAACTTCAATTGGTGAGTTTTGCTCT

CCCTAATCCAGCTTTTTAAAGACAAGTCCTTTTATATGTATTTTAAACCTGCAGACATAAGGGAAAATGCTGTTAATAACATATATTAAACCCTGATAAT

TTTCTGAGGACTTTGGTACTAGCATCTTCTTTAACACTTCAGGTAACTGAGGCATGAATACCTTAATCACTTGCCCAAAGTAATTATTGGCCACTGGCAA

GCCTGTTCTCATTCCTGGGAGATTCAAGAAAAGGCTAAAGGTAACTTCTGCACACTTGGAGCCACCTTTTCATAAACTTGCCTTATGTCTGGAGGTTTAG

ATCATTTCTCCACCTGTGACTTTAAGGCTTTATATCTCTGGCATGAAGGATTCTTTCAAGTAAGTCCCAAAATGACCACTGACCTGGTTATGCAACTGAC

TTTCACTTGCAATTTCAAGTGAGAGTTGGCCATTGTTGCTCACTTTCTGTGGACTGAATCAAGGCTTATATTTTATGCCTTTCTGTGGCGCCATAGCTGT

ACAATTACTAATAATTTCTTGTCAGAAGCCTCTGAAATGGTTTAGCACAGACATGGGCACGCAGCTAACTGATTAGCCATATGTTTCCATTTTGAATCTA

AATAATCAAGTGAAAGAAACATCCACATGTTGATGAGGAAAACTAAGTGAAAGGCTTTCCACAATGCCACTTGTCCCAGTGGGGAACATGGACTTTGTGT

GTGCCAGGACACACAAGAGGAGAACATAAAAATATGAAATAAAATATGATCATCTCCCTGAGGGAAGGTTTCTTTCCTTAAAGCAGAACAGGGTAATTGA

AGGTTGCTGTTGCTTGAATATAGAAATAGTTGACCTTCCAGCCCCCTTCCCTTCACTTGTTTGTTAGGAGATGAGACTGAGGCCTATGCATCAGTGCCTT

TCCCTGTTATAGCGAGACCTACAGATAGAAGCCAGAGTCGCAGCAACTGTATAAAGCAATGGTTCACTGCAGTGTACACCTGAAGCTTGTGATGGGATGG

ACTCACTGGCATCCTTCTTATAAAAGTCATAGGCAGTGACTCTAGGTATGATGACATCACAGGAGTAAGGGAGAAATGCTGGTTTCTGTTAACACCAACA

ACATTGCCAGCAAGTGCATAGTTAAAGTGAGTCATTTGTTTTTTTAAAGGCAACACCTGTGAAGGTTACTGAGTGTGGCACACCGTAGTTTGTTCACTCA

TTTAAGCATTTCTCTGCACCAGCTACTATCAATATTGGTTACATCAGGGAATGCAAAAATGTGTGTGCACATTATCCCTACCCAGGGATGTAGATGTGAA

GGGCTGAAGAGGGTATGGAATAAAGAAGTGCATAAAACAAGCAACCACCCCCACAGAGAGTGACTCAAGCATTTCTATGTCTCAGTGTCAGGAATGCAGG

GTCTCAGGAATCAGGATGGGTCTTGTCATTTTCATAGCCTCCCCACAATCTACTAATTACATATAGATTAGAAGTCAGGAACGAAGCTCCATCTCCTCGT

TGGCTGGCTGAGCATTCTCCCCATCAGTATCTCTATCTGAGCATTCTCCCCATCAGTATCTCTATCTGAGCATTCTCCCCATCAGTATCTCTAGCATCTT

TTTAGGTCCTTCTCAGAGTCATTGAGTGAACGTCCATCTTTTTACTTGCTTAGTTCAAAATGTGTTTTGTGTAGTCTTCCTTGCTTAGAATACCACATCA

TTTTAAAACGTGGTTTCCTTGAGAAGTTACGTGGTATGTTATCTGACAAATGCAAAGAAATAGAATCTCTTCATTATGTGGTGAGATCATTCAGGTGTAA

ATAGTGTTTGGGGAATTTGATAAATTTGCAATAGTGTTATAAGAAAATCAAGAGAAAAGACTCCATGATAAAACATCCTGGTCTTCCATGCTCATTTATC

ATGTAATGATTGTTACCAAGTACCTACTTTTTATTCACTGCAAAGAACCAGCTTGTATATTCTCCCTGGTATACAACCTCTTGAAGTTTTCATAACATCC

ACGGAAAGAAGTTACCATTTCCCCACATCATAGTATAGTT
Translation
MESPTKEIEEFESNSLKHLQPEQIEKIWLRLRGL - UNI38424 - LRKYKKTSQR - UNI38424 - RLRSLVKQLERGEASVVDLKKNLEYAAT

VLESVYIDETR - UNI38424 - RRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVER RMYRRTSNMVGL

SYPPAVIDALK DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFK IPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVA 

NWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTR RSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWR REFRTLVIEMVMATDMSCHF

QQIKAMKTALQQPEA AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQ GDREAELGLPFSPLCDRKSTMVAQSQVG GFIDFIVEPTFTV

LTDMTEKIVSPLIDESSQTGGTGQRRSS SLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKE EEKAKKEAEE

KARLAAEEKQKEMEAKSQAEQGTTSKGEKKTSGEAKSQVNGTRKGDNPRGKNSKGEKAGEKQQNG GDLKDGKNKADKKDHSNTGNESKKTDG GTKKRS

HGSPAPSTSSTSRITLPG GDYG
Transcript ENSMUST00000044505
Sequence
AAATCCTCTGGGGAGCCGCCGGTAGCTTCTTTGGCTTTGTTTGAAGGGAAAAAGAACAGGAACAGAGTCGAGGCGCTTTCTCCCGGACACAGTCCTTATC

CCTGTCCCTGGCAGTAGTAAGCATCATGGCTGGTTTCCACAGCTGCCTCCAGCGCGCACCTGGGGCCGGAGTCCCCTGTGATCCTTGCAGGCTCTGAGCC

ATCTCTGGGGACGCTGCAGGGGAAGTGACAAAGTGACTGAAAGACTCACTGGGCTGGACCCAGCAAGGAGAGGAGGCTGGGAAGGGACTACACAAACTCT

CTCCACCTCACCCTCAGTGAGAACCTGCAGCTATGGAGTCTCCAACCAAGGAAATTGAAGAATTCGAGAGCAACTCTCTGAAACACCTGCAACCTGAGCA

GATCGAGAAAATCTGGCTTCGGCTCCGCGGGCT - UNI38424 - GAGGAAATATAAGAAAACGTCCCAGAG - UNI38424 - GTTACGGTCTTT

GGTCAAGCAATTAGAACGAGGAGAGGCCTCTGTGGTAGACCTTAAGAAGAATCTGGAATATGCAGCCACAGTGCTTGAATCTGTATATATTGATGAAACA

AG - UNI38424 - GCGACTGCTGGATACAGAGGATGAGCTTAGTGACATTCAATCAGATGCTGTGCCTTCAGAAGTTCGGGATTGGCTGGCCTCCAC

CTTCACACGGCAGATGGGGATGATGCTTAGGAGAAGTGATGAGAAGCCCAGGTTCAAGAGCATCGTCCATGCGGTGCAAGCTGGGATATTTGTGGAAAG 

AATGTACAGACGGACATCAAACATGGTTGGGCTGAGCTATCCACCGGCTGTAATCGATGCATTGAAG GATGTGGATACGTGGTCCTTCGATGTCTTTTC

CCTCAATGAGGCCAGTGGAGATCATGCACTGAAGTTCATTTTCTATGAATTACTCACACGTTATGACCTGATCAGCCGTTTTAAG ATACCGATTTCTGC

ACTTGTCTCATTTGTGGAGGCCCTCGAAGTGGGTTACAGCAAGCACAAAAATCCTTACCATAACCTGATGCATGCAGCTGACGTCACACAGACTGTGCAT

TACCTCCTTTATAAGACAGGAGTAGCA AACTGGCTGACAGAGCTGGAGATCTTTGCAATAATCTTTTCGGCTGCCATCCATGACTATGAACATACTGGA

ACTACAAACAATTTCCACATTCAGACTCG GTCAGATCCAGCTATCCTGTACAATGACAGATCTGTCCTGGAGAACCACCACCTGAGTGCAGCCTACCGC

CTTCTGCAGGAAGACGAAGAGATGAATATTCTGGTTAACCTCTCAAAGGATGACTGGAG GGAGTTTCGAACTTTGGTTATTGAGATGGTAATGGCCACA

GATATGTCCTGTCATTTCCAGCAAATCAAAGCCATGAAGACAGCCCTGCAGCAACCAGAAGC AATTGAGAAGCCGAAAGCCTTATCCCTCATGTTACAC

ACAGCAGACATCAGTCATCCTGCGAAAGCATGGGACCTGCACCACCGCTGGACCATGTCTCTCCTGGAGGAGTTCTTTAGACAG GGTGACAGAGAAGCA

GAGCTGGGGCTGCCATTTTCTCCTCTTTGTGACAGAAAGTCAACCATGGTTGCTCAGTCACAAGTGG GTTTTATTGACTTCATTGTGGAGCCCACCTTC

ACTGTGCTCACGGACATGACCGAGAAGATTGTGAGTCCATTAATTGACGAAAGCTCCCAGACTGGTGGGACAGGGCAGAGGAGATCAAG TTTGAACAGC

ATCAACTCATCAGATGCAAAGCGATCCGGTGTCAAGAGTTCTGGGTCAGATGGAAGTGCTCCCATCAACAATTCTGTCATTCCTGTTGACTATAAGAGTT

TTAAAGCCACTTGGACTGAGGTGGTGCAGATCAATCGGGAGCGGTGGCGAGCCAAGGTACCCAAAG AAGAAAAAGCCAAGAAGGAAGCTGAAGAGAAGG

CTCGCCTGGCTGCTGAGGAAAAGCAAAAGGAAATGGAAGCCAAAAGCCAAGCTGAACAAGGCACAACCAGCAAAGGCGAGAAAAAGACATCAGGAGAAGC

CAAAAGTCAAGTCAATGGAACACGCAAGGGTGATAACCCTCGTGGGAAGAACTCCAAAGGAGAAAAGGCAGGCGAAAAGCAGCAGAACG GTGACTTGAA

AGACGGTAAAAATAAGGCAGACAAGAAGGATCACTCCAACACCGGAAATGAGTCAAAGAAAACAGATG GTACAAAGAAGCGTTCTCATGGCTCACCTGC

TCCGAGCACTAGTTCCACAAGTCGCATTACCTTGCCAG TCATCAAGCCTCCTTTGCGTCACTTTAAGCGTCCTGCTTATGCATCTAGCTCCTATGCACC

TTCCGTCCCGAAGAAAACTGATGATCATCCTGTAAGATACAAGATGCTGGATCAGCGGATCAAGATGAAAAAGATCCAGAACATCTCTCATCACTGGAAC

AAAAAATAG
Translation
MESPTKEIEEFESNSLKHLQPEQIEKIWLRLRGL - UNI38424 - LRKYKKTSQR - UNI38424 - RLRSLVKQLERGEASVVDLKKNLEYAAT

VLESVYIDETR - UNI38424 - RRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFVER RMYRRTSNMVGL

SYPPAVIDALK DVDTWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFK IPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVA 

NWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTR RSDPAILYNDRSVLENHHLSAAYRLLQEDEEMNILVNLSKDDWR REFRTLVIEMVMATDMSCHF

QQIKAMKTALQQPEA AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQ GDREAELGLPFSPLCDRKSTMVAQSQVG GFIDFIVEPTFTV

LTDMTEKIVSPLIDESSQTGGTGQRRSS SLNSINSSDAKRSGVKSSGSDGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKE EEKAKKEAEE

KARLAAEEKQKEMEAKSQAEQGTTSKGEKKTSGEAKSQVNGTRKGDNPRGKNSKGEKAGEKQQNG GDLKDGKNKADKKDHSNTGNESKKTDG GTKKRS

HGSPAPSTSSTSRITLPV VIKPPLRHFKRPAYASSSYAPSVPKKTDDHPVRYKMLDQRIKMKKIQNISHHWNKK

For any suggestions or comments, please send an email to unitrap@crg.es