Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004455 (Ppp1cc)
Chromosomal location
Chr 5: 122608365 - 122625276 (+)
Description
protein phosphatase 1, catalytic subunit, gamma isoform Gene [Source:MGI (curated);Acc:Ppp1cc-001]
RefSeq_dna
NM_013636 
RefSeq_peptide
NP_038664.2 
UniGene
Mm.280784 Mm.397825 
MGI
MGI:104872 
Uniprot/SWISSPROT
P63087 
Uniprot/SPTREMBL
Q3U7K1 Q6ZWM8 
Human Ortholog
ENSG00000186298 (PPP1CC)
Omim not available
UniTrap UNI134
Vector Insertion
Chr 5: 122608625 - 122618183
Public Clones GC0086 (tigem) (sanger) YTC281 (baygenomics) D006D02 (ggtc) P032E10 (ggtc)
P137H12 (ggtc) W247A01 (ggtc) D144F10 (ggtc) P138H12 (ggtc) P015D04 (ggtc)
E055E11 (ggtc) P012E12 (ggtc) 3SE307G04 (ggtc) CMHD-GT_504G5-3 (cmhd) PST7999-NR (escells)
PST5533-NR (escells) IST14792G5 (tigm) IST10441A1 (tigm) IST10469E2 (tigm)
IST10441A2 (tigm)
Private Clones OST288864 (lexicon) OST266369 (lexicon) OST261296 (lexicon) OST252619 (lexicon)
OST252150 (lexicon) OST222107 (lexicon) OST214493 (lexicon) OST168855 (lexicon)
OST68162 (lexicon) OST67698 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5260
Vector Insertion
Chr 5: 122618316 - 122618927
Public Clones YTA506 (baygenomics) RRR804 (baygenomics) CMHD-GT_453E4-3 (cmhd)
Private Clones OST445198 (lexicon) OST131237 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5533
Vector Insertion
Chr 5: 122619159 - 122621830
Public Clones YTA150 (baygenomics) M009B04 (ggtc)
Private Clones OST454629 (lexicon) OST339242 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23724
Vector Insertion
Chr 5: 122621936 - 122622740
Public Clones not available
Private Clones OST247749 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6077
Vector Insertion
Chr 5: 122624125 - 122624988
Public Clones YHD158 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000086294
Sequence
GGCGAGAGGAGGAGGAAGCCCGGAGCGGAGCGGGGCGGCTGGGGGGGGTGGACCCGCCGCGGCTGCTGCTGCCACCGCCGCCGCCGCCACCACCGCTCGT

GGGGCTCGTGGCGTGAGGAAGGAGGACGAGTGAGACCCCGGGGCGAGCGGGCGGCGGCGCCGCTGCTGCTGCTGCTGCTGCGGGAGGGTCGGCGGCGGGA

CGGCGATGGCGGATATCGACAAACTCAACATCGACAGCATCATCCAACGGCTGCTGGAAG - UNI134 - TGAGAGGGTCCAAGCCAGGCAAGAATGT

CCAGCTCCAGGAGAACGAGATCCGAGGACTCTGCCTGAAGTCTCGGGAGATCTTCCTCAGTCAGCCTATCCTTTTAGAACTTGAAGCACCACTCAAGATA

TGTG - UNI5260 - GTGACATCCACGGGCAGTACTATGATTTGCTCCGTCTGTTTGAATACGGTGGCTTTCCTCCAGAGAGCAACTATTTGTTTCTC

GGGGACTATGTGGACAGGGGCAAGCAGTCCCTGGAGACAATCTGCCTCTTGCTGGCCTACAAAATCAAGTATCCGGAGAACTTCTTTCTTCTCAGAGGGA

ACCACGAGTGCGCCAGCATCAATAGGATCTACGGATTTTATGATGAGT - UNI5533 - GTAAAAGAAGATACAACATTAAGCTGTGGAAAACGTTCA

CAGACTGTTTTAACTGCTTGCCGATAGCAGCCATCGTGGACGAGAAGATATTCTGCTGTCATGGAG - UNI23724 - GTTTATCACCAGATCTTCAA

TCTATGGAGCAGATTCGGCGAATTATGAGACCAACTGATGTACCAGATCAAGGTCTTCTTTGTGATCTTTTGTGGTCTGACCCCGATAAAGATGTCTTAG

GCTGGGGTGAAAATGACAGAGGAGTGTCCTTCACATTTGGTGCAGAAGTGGTTGCAAAATTTCTCCATAAGCATGATTTGGATCTTATATGTAGAGCCCA

TCAG GTGGTTGAAGATGGCTATGAGTTTTTTGCAAAGAGGCAGTTAGTCACTCTGTTTTCTGCACCCAACTACTGTGGCGAGTTTGACAATGCAGGCGC

CATGATGAGTGTGGATGAGACCCTCATGTGTTCCTTCCAG ATTTTAAAGCCTGCAGAGAAAAAGAAGCCCAACGCCACGAGACCTGTCACACCACCACG

GG - UNI6077 - TTGGATCAGGCCTGAACCCGTCCATTCAGAAAGCTTCAAATTATAGAAACAACACTGTCCTATACGAGTGA
Translation
MADIDKLNIDSIIQRLLEV - UNI134 - VRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICG - UNI5260 - GDIHGQYYDLL

RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC - UNI5533 - CKRRYNIKLWKTFTDCFNCL

PIAAIVDEKIFCCHGG - UNI23724 - GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLI

CRAHQ VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ ILKPAEKKKPNATRPVTPPRV - UNI6077 - VGSGLNPSIQKASN

YRNNTVLYE
Transcript ENSMUST00000102528
Sequence
GGCGAGAGGAGGAGGAAGCCCGGAGCGGAGCGGGGCGGCTGGGGGGGGTGGACCCGCCGCGGCTGCTGCTGCCACCGCCGCCGCCGCCACCACCGCTCGT

GGGGCTCGTGGCGTGAGGAAGGAGGACGAGTGAGACCCCGGGGCGAGCGGGCGGCGGCGCCGCTGCTGCTGCTGCTGCTGCGGGAGGGTCGGCGGCGGGA

CGGCGATGGCGGATATCGACAAACTCAACATCGACAGCATCATCCAACGGCTGCTGGAAG - UNI134 - TGAGAGGGTCCAAGCCAGGCAAGAATGT

CCAGCTCCAGGAGAACGAGATCCGAGGACTCTGCCTGAAGTCTCGGGAGATCTTCCTCAGTCAGCCTATCCTTTTAGAACTTGAAGCACCACTCAAGATA

TGTG - UNI5260 - GTGACATCCACGGGCAGTACTATGATTTGCTCCGTCTGTTTGAATACGGTGGCTTTCCTCCAGAGAGCAACTATTTGTTTCTC

GGGGACTATGTGGACAGGGGCAAGCAGTCCCTGGAGACAATCTGCCTCTTGCTGGCCTACAAAATCAAGTATCCGGAGAACTTCTTTCTTCTCAGAGGGA

ACCACGAGTGCGCCAGCATCAATAGGATCTACGGATTTTATGATGAGT - UNI5533 - GTAAAAGAAGATACAACATTAAGCTGTGGAAAACGTTCA

CAGACTGTTTTAACTGCTTGCCGATAGCAGCCATCGTGGACGAGAAGATATTCTGCTGTCATGGAG - UNI23724 - GTTTATCACCAGATCTTCAA

TCTATGGAGCAGATTCGGCGAATTATGAGACCAACTGATGTACCAGATCAAGGTCTTCTTTGTGATCTTTTGTGGTCTGACCCCGATAAAGATGTCTTAG

GCTGGGGTGAAAATGACAGAGGAGTGTCCTTCACATTTGGTGCAGAAGTGGTTGCAAAATTTCTCCATAAGCATGATTTGGATCTTATATGTAGAGCCCA

TCAG GTGGTTGAAGATGGCTATGAGTTTTTTGCAAAGAGGCAGTTAGTCACTCTGTTTTCTGCACCCAACTACTGTGGCGAGTTTGACAATGCAGGCGC

CATGATGAGTGTGGATGAGACCCTCATGTGTTCCTTCCAG ATTTTAAAGCCTGCAGAGAAAAAGAAGCCCAACGCCACGAGACCTGTCACACCACCACG

GGGTATGATCACAAAGCAAGCAAAGAAATAGATGTCACTTGACACTGCCTGGTTGGGACTTGTAACATAGCGTTCATAACCTTCCTTTTTAAACTGTGAT

GTGCTGGTCAGCTTGCCCAGGTAGACCTGTCTGTCGGGCCCTCCTCCATTTGATTACTGCTGGCACTTGCTGGTTATAGCAGCAAGCCAAGCACTTCATT

CTCAAGAGAGCATTTTGTTTTGAACCTCTGTTCCCTTTGTGGACAGCTCTGATGATGGTGTTAAGCTGTACACCCTGGCAGGTTATCCTGTCTGAGGAGA

AAGTGTACAATTGATCTTTTTTTAATTTAGTATAAGTCATGAATAATGTAAATGCCTGTTTTCTTTAGGATATAAAGAGAGCCTTAGAGTGCGTGAGTCT

CTACATGTAATTGTCATAAATGCATTCTGTTGATACAAACCACTGTGAACAATTTTTTTTCCAGTTTGTTTGAAAGGGACTGCTTTCCCTCATTGTCTTG

TCATGTACAAACTAGTGTCTGCAGCTGTGGCAGCAGGAGTGACCTGCCTGCCGCCAGCCCTGCCCAGACTATCTGAAGCACACTCCTTCCCACTGCACAT

TTAATAATGATTAAAGCCATTCTTTTCAATGTCTGTGATTCCTTCCTAAAGCCAAAGTTTCTGTTGGACTGTATGGCACGCCCTGGGGATGAGGTGGCCA

GGGCATCGAGGCTGCGTGCACAGGCCGCCTCCCTCCGTGGGGCCTCAGAAGCAGGTTATTTTAACTAGCAATAGTGGTATAGTGCTGAGTAAGCTATTAA

TGATGGAAGTTAATGACACTTTGTACAGTTCCCATATAGTCTATTCACTGAGTGATCTTTTTACAGTTGGATCAGGCCTGAACCCGTCCATTCAGAAAGC

TTCAAATTATAGAAACAACACTGTCCTATACGAGTGACCGATAATGCTTTCTTTGGCTACATTCTTTATTCTGCGGTGACATTGAGGCTTATAAATCAAA

AGGAACTAACTTGCCGTCCACCGGTTTATACAGAACTCACAGTATCTATGACTTTTTTAAACTACGACCTGTTAAATGAATCTGTTTGCACAGATGCCCG

TGTACAATGCCATGTGCTGAGAATGGTTTCAGACTTATTAAATGCAAGCTTGTT
Translation
MADIDKLNIDSIIQRLLEV - UNI134 - VRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICG - UNI5260 - GDIHGQYYDLL

RLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC - UNI5533 - CKRRYNIKLWKTFTDCFNCL

PIAAIVDEKIFCCHGG - UNI23724 - GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLI

CRAHQ VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ ILKPAEKKKPNATRPVTPPRGMITKQAKK

For any suggestions or comments, please send an email to unitrap@crg.es