Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004530 (Coro1c)
Chromosomal location
Chr 5: 114292448 - 114358715 (-)
Description
coronin, actin binding protein 1C Gene [Source:MGI Symbol;Acc:MGI:1345964]
RefSeq_dna
NM_011779 
RefSeq_peptide
NP_035909.2 
MGI
MGI:1345964 
Uniprot/SWISSPROT
Q9WUM4 
Uniprot/SPTREMBL
Q3TEU8 Q3TF74 Q3U8F0 Q499X7 Q5PPQ7 
Human Ortholog
ENSG00000110880 (CORO1C)
Omim not available
UniTrap UNI9904
Vector Insertion
Chr 5: 114332167 - 114358619
Public Clones NPX358 (baygenomics) (ggtc) E132D10 (ggtc) P056B03 (ggtc) D141F11 (ggtc)
M064D08 (ggtc) IST14271A11 (tigm) IST10394F2 (tigm) IST15062B11 (tigm)
IST14398E10 (tigm) IST14631G4 (tigm) IST13337D12 (tigm) IST14404H11 (tigm)
IST15060F3 (tigm)
Private Clones OST430876 (lexicon) OST386420 (lexicon) OST329754 (lexicon) OST167637 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2633
Vector Insertion
Chr 5: 114315771 - 114331966
Public Clones (sanger) XP0266 (sanger) XR1012 (sanger) RRN126 (baygenomics)
Private Clones OST446459 (lexicon) OST383197 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3000
Vector Insertion
Chr 5: 114302310 - 114315647
Public Clones XR0258 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22959
Vector Insertion
Chr 5: 114299658 - 114300659
Public Clones not available
Private Clones OST280268 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37363
Vector Insertion
Chr 5: 114292447 - 114295416
Public Clones PST26381-NR (escells) PST22479-NL (escells) PST22457-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000004646
Sequence
GCGGCGCTCAGTGCCAGGCGGGAGGCGGCAGCGGTTGGAGGCTTCGCGGGGCTTTGCAGCAGGGACTTCGGCGGCGCCTCAGGCACCCGGGCTCTG - U

NI9904 - ACACGATGCGGCGAGTGGTGCGGCAGAGCAAGTTCCGCCACGTCTTTGGACAGGCGGTGAAGAATGACCAGTGCTATGACGACATCCGTGT

CTCCCGAGTCACCTGGGACAGTTCCTTTTGTGCCGTCAACCCCAGATTCGTGGCCATCATCATAGAAGCGAGTGGGGGAGGGGCCTTCCTGGTGCTCCCT

CTGCACAAG - UNI2633 - ACGGGACGAATTGACAAATCCTACCCTACAGTGTGTGGCCACACAGGACCAGTGCTGGACATAGACTGGTGTCCACAT

AATGACCAGGTCATTGCCAGCGGCTCAGAGGACTGCACTGTTATG - UNI3000 - GTTTGGCAGATCCCGGAAAATGGACTCACCCTTTCCCTGACC

GAGCCTGTGGTGATTCTAGAAGGGCACTCAAAAAGAGTTGGCATCGTGGCCTGGCACCCGACGGCCCGCAATGTGCTTCTCAGTGCAG GCTGTGATAAT

GCCATTATCATCTGGAACGTGGGGACAGGGGAAGCCCTCATCAACTTGGACGATATGCATTCAGACATGATTTACAATGTGAGCTGGAGCCGTAACGGTA

GTCTCATCTGCACCGCATCCAAAGACAAGAAAGTGAGAGTCATTGACCCCAGGAAACAGGAGATTGTGGCG - UNI22959 - GAGAAGGAGAAAGCA

CACGAAGGAGCCAGGCCTATGCGTGCCATCTTCCTGGCGGACGGCAACGTCTTCACTACTGGCTTTAGCCGCATGAGCGAGCGGCAGTTGGCGCTCTGGA

ACCCA AAAAACATGCAGGAACCAATTGCTCTCCATGAAATGGACACTAGCAATGGGGTGCTGCTCCCCTTCTACGATCCGGACACCAGCATCATCTACT

TATGTGGGAAG GGTGACAGCAGTATCCGCTATTTTGAGATCACGGATGAATCCCCATATGTCCACTACCTCAACACATTCAGCAGCAAGGAGCCTCAGC

GAGGGATGGGCTACATGCCCAAGCGGGGCCTTGACGTCAACAAGTGTGAAATTGCCAG ATTCTTCAAGCTTCATGAGAGAAAGTGCGAGCCCATTATCA

TGACGGTCCCCAGGAAG TCTGACCTCTTCCAAGACGACCTGTACCCTGACACGGCAGGGCCGGAAGCCGCCCTTGAGGCCGAGGAGTGGTTTGAGGGGA

AGAACGCGGACCCCATCCTCATATCGTTGAAGCACGGGTACATTCCAGGCAAGAACAGGGACCTCAAGGTGGTCAAGAAGAACATCCTGGACAGCAAGCC

GGCTGCAAACAAGAAGAGCGAGCTCAGCTGTGCCCCCAAGAAGCCCACAGACACGGCCAGTGTG CAAAACGAAGCCAAGTTGGATGAGATTCTGAAAGA

GATCAAATCCATAAAGGAAACAATCTGCAGTCAAGACGAGCGCATTTCCAAGTTGGAGCAGCAGCTGGCGAAGATGGCTGCCTGAGGCCCGCCCACCTCC

ACGGACGGTGGCTGCTCCTCCTCCGCGCACTCCCAGGGAGGGCAGAGAGGGAGACACTGCCATTTGGAGACATTCCATGTCAGATCTGTCAGCCAGCGAT

AGGCCACATTCCAGTAAGAACTCGGTTCCTCTCCCAAATTTCCGCAAACCTGGAAGCTGAGCTTTTCGTCAGGGAGCTTTGGTGTTCGGCAGGTCTGCTG

ACTTGCTGAGCTTTCCTACGTTTGAAATGCCAGATGTTCTGAATTTTAGAGACCAAGCCCCCCACTTGACCCAGCGTCCTCCTCACACACCTGATGACCG

GGCCAGCGCCACCTCTGCTCTGTCTCTTCCTTTTTAATGTTGCCAAAACCGAAAGTAGCTTTTTTTTCTTTGTATTTTTCTACTTTGCAGTATTTGTGGG

GTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTCTCTCCTCAATTTAAAAGGGACAGCACTGTGTATGTTTA

TAAACTAAATGAAGATGAGATGATTATTTTGTATAAACACTCACGAGAACAATCAGTGCAGCCGCCTGCACAGGGCTGGCTCACTCACAGCACAAACCTG

GGCGTTAGTCTAACGACTGTGCAGAAGGAAGACTTGAGAAATCACGTGGACCCACCACACACTGCCCCCATTCCATTGAGTCTTCGATCAAAAGTCCTGT

CTCTCTCTCTCCTTGCTCTCTCTCTCCTAGAAGTTGGGTGGTTGCACAGAGGGAACTCGGTGATTATACTCTAACCCGAACTAGCTCGCGTTTCTGCAGT

TTTGTTCTCCACAGATGGTTGTGCCTGTCCCTTCCAGCAGTGTGGTTCCCTTCCGGGCAGTTTGGACAAGGGCACCCAAGGCGAGCGGATACCTGTGTGT

TGACAGTCCTTGTCTACAGAGGCAGCTTGCCTGGCCCTTGGGTATAGTGTGGGGCTTGAACCCAGGCACTGTGTGCACAGCCTCTGCCCCAGGCCCTCTG

TTTCCCTCGCTCCTGTCTTCCCTCCTTACTTTGCTGCCTCCTGTCTCAAGCGCCCAGCCAGCCCTCGAGGGCTCTTGAATGTTGCAGCGGAGGGAAAGGT

CCAGAACAGAGTGGAAAGGGAAGTTCAGAGATCGACCATAGCTGGCCACGCACAGGCCCTCTGCCCCACCACCCAGATCAGGCTGCTACTTGCCAGCACT

GGACGTGCCCTGGGCATGCCTGCTCCAAGGGCAGCAGCTAGACCTTAGCCCTACTCTAACCTCACAGCCTCATGGTGCGTGTCTATGGAAGCAGACGACC

TGGGTAGTGTCAGATGGATCACAAAAGGCAAGCCTTGGCAAGTGTTGGTGCTGGTGTGGGCCCAGTGCTGGCTGCCAGCAAATGTACAGGTTATCAGGGC

AGAGCATAGTATGGCAGCAGCCGCTTAGAGTGTGTGGACTGACTGGGTAGTGTTGTAAGAAAAGGTTCTCTCAGCCACCGAGATGGGGGCCGCTGGCTCC

GAAGCTTCGGGGCTCCTGAGTCTCTGTAGGTTTCTGTGTCTGTCTTGTGGTTTAATGTTGGATAAGGAGATGGAGAGACCATGGCTGGAATGACTCACAC

TGCATTGTCTGTACGTGTGCTACGCTGAGGACTGTGTGAAGATTCACAAAGGTTCTGGGGTCCGTTGAATTAATTACGTAACAATTGTAGAGGCTGTTGA

TGAAGTCAGAGGGGCTGTGGTTGAGAGAGGCGGGAGTGACTGTAGTGTGTGCCCACCTGACACGCTGTGGTGGCCTCTGTTTCCCTGTGGCACCGGAGGA

AGACAGTGAACTGCTCCTACACCCACTCTTATAGAGTGGCCATAGTGTTCTGTCAAAACACTCGCTTCCGTTTTCAGAGATAAAAGGCATTGATT
Translation
 - UNI9904 - MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHK - UNI2633 - TGRIDKSYP

TVCGHTGPVLDIDWCPHNDQVIASGSEDCTVM - UNI3000 - VWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAG GCDNAIIIWN

VGTGEALINLDDMHSDMIYNVSWSRNGSLICTASKDKKVRVIDPRKQEIVA - UNI22959 - EKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQL

ALWNP KNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGK GDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIAR RFFKLHER

KCEPIIMTVPRK SDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPAANKKSELSCAPKKPTDTASV QNEA

KLDEILKEIKSIKETICSQDERISKLEQQLAKMAA

For any suggestions or comments, please send an email to unitrap@crg.es