Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004552 (Ctse)
Chromosomal location
Chr 1: 133534891 - 133572080 (+)
Description
cathepsin E Gene [Source:MGI (curated);Acc:Ctse-001]
RefSeq_dna
NM_007799 
RefSeq_peptide
NP_031825.2 
MGI
MGI:107361 
Uniprot/SWISSPROT
P70269 
Uniprot/SPTREMBL
Q3UKT5 Q4FK00 
Human Ortholog
not available
Omim not available
UniTrap UNI34902
Vector Insertion
Chr 1: 133535135 - 133558452
Public Clones (sanger) IST11549E1 (tigm) IST10871D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112411
Sequence
CCATCCACTTACTACAAGAAAACGAAATTCTTGACATTTTGGGTTATATCCGGTAACTTCAAAG - UNI34902 - ACTGGGCAGGGCAGGTCTGGGC

ACCAGGAAGAGCCAGTGCCCCTGCCCTGTGATCAAGAGGAGAGAAGGGTGGAAGGGAGATCGGAGCAGAGTGAGAGAGAAGCTACCCCTTGGACCACAAT

GAAGCCCCTCCTTGTGCTGCTGCTGCTGCTGCTCCTGGATCTGGCTCAGGCCCAAGGTGCTCTGCACAG AGTGCCCCTCAGAAGACATCAGTCCCTTCG

GAAGAAACTACGGGCCCAAGGACAGCTCTCAGAATTCTGGAGGTCTCATAACTTGGACATGACCCGACTCAGCGAGTCCTGTAATGTGTATTCGAGTGTC

AATGAACCCCTCATCAACTACCTGGAT ATGGAATACTTTGGCACCATCTCCATCGGCACCCCGCCGCAGAACTTCACTGTCATCTTTGACACCGGTTCA

TCCAACCTCTGGGTCCCTTCTGTGTACTGCACCAGCCCAGCATGCA AGGCACACCCAGTATTCCATCCATCGCAGTCCGACACATACACGGAGGTAGGG

AATCATTTCTCCATCCAGTATGGTACCGGGAGCCTGACAGGAATCATTGGAGCTGATCAAGTCTCT GTGGAAGGGTTGACTGTGGATGGCCAGCAGTTT

GGAGAAAGTGTCAAGGAGCCAGGCCAGACCTTTGTGAATGCAGAGTTTGATGGGATTCTGGGTCTGGGATACCCCTCATTGGCTGCTGGAGGAGTGACCC

CAGTGTTTGACAACATGATGGCCCAGAACCTTGTGGCTCTGCCTATGTTTTCTGTCTACTTGAGCAG TGACCCTCAAGGTGGCTCAGGCAGTGAGCTGA

CTTTCGGAGGCTATGACCCCTCTCATTTCTCTGGGAGCCTCAACTGGATCCCAGTCACCAAGCAAGCCTATTGGCAGATTGCCCTGGATGG AATCCAGG

TGGGAGACACTGTGATGTTCTGCTCCGAAGGCTGCCAGGCCATAGTGGACACAGGGACCTCTCTCATCACTGGCCCCCCCGACAAGATCAAACAGCTTCA

AGAGGCCATTGGGGCCACACCCATTGATGGAGAA GACTTGGTGGAAGGAATGCAGTTCTGTGGCAGTGGCTTTCAAGGACTTGACATTCCACCTCCAGC

TGGGCCCCTCTGGATCCTGGGGGATGTCTTCATCCGACAGTTCTACTCAGTCTTTGACCGTGGAAATAACCAAGTGGGATTGGCCCCCGCAGTTCCCTAA

AGAGGGATGTATGCCTACATATGGATGCCTGATACCCATTTAACCTGTTAGATACCTTTGTAACTATCAAAGCCGTCATTTCCCATGGGGTGTAGCCACC

CCAGAGTATTCAGACCAATCAAAGCATAAGAGTGCACCCCACTCACTGCAAACACACACACACACACACCACCTCTACCATCACCACGATGAAAGAAGTT

CTGTCTATAGTCTTCACTGCTTATTGTTGACTTTCTATTATGGAAATCTCTAAACATGTACACAGTAGACACGATGGCAAGATAAATACCCACACACCTC

TGCCTCAGGTCACAACCCATCCATGTGTGGCCCAGACTCTCTATCTTCCATCCCTCTGGTTCCACGCCTCTAGATTTGGAAGCAGATTCTAAGCACCAGG

TCATTTTATCTAATGTCTAACATCCTTACAAATCAGAATTTAAATGTCTCACCCTCTCATAAATGTGGACCTGTTTTTACAGTTGGTTTATTTGTATCAG

GATTAAAACCAGATCCATAACTGGACAAAAAAAACCCATAAACTGATTTGATTTTAAA
Translation
 - UNI34902 - MKPLLVLLLLLLLDLAQAQGALHR RVPLRRHQSLRKKLRAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEPLINYLD MEYFGTI

SIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACK KAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVS VEGLTVDGQQFGESVKEPGQTFVNA

EFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSS SDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDG GIQVGDTVMFCSEG

CQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGE DLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVP
Transcript ENSMUST00000116536
Sequence
AAGAGGAGAGAAGGGTGGAAGGGAGATCGGAGCAGAGTGAGAGAGAAGCTACCCCTTGGACCACAATGAAGCCCCTCCTTGTGCTGCTGCTGCTGCTGCT

CCTGGATCTGGCTCAGGCCCAAGGTGCTCTGCACAG AGTGCCCCTCAGAAGACATCAGTCCCTTCGGAAGAAACTACGGGCCCAAGGACAGCTCTCAGA

ATTCTGGAGGTCTCATAACTTGGACATGACCCGACTCAGCGAGTCCTGTAATGTGTATTCGAGTGTCAATGAACCCCTCATCAACTACCTGGAT ATGGA

ATACTTTGGCACCATCTCCATCGGCACCCCGCCGCAGAACTTCACTGTCATCTTTGACACCGGTTCATCCAACCTCTGGGTCCCTTCTGTGTACTGCACC

AGCCCAGCATGCA AGGCACACCCAGTATTCCATCCATCGCAGTCCGACACATACACGGAGGTAGGGAATCATTTCTCCATCCAGTATGGTACCGGGAGC

CTGACAGGAATCATTGGAGCTGATCAAGTCTCT GTGGAAGGGTTGACTGTGGATGGCCAGCAGTTTGGAGAAAGTGTCAAGGAGCCAGGCCAGACCTTT

GTGAATGCAGAGTTTGATGGGATTCTGGGTCTGGGATACCCCTCATTGGCTGCTGGAGGAGTGACCCCAGTGTTTGACAACATGATGGCCCAGAACCTTG

TGGCTCTGCCTATGTTTTCTGTCTACTTGAGCAG TGACCCTCAAGGTGGCTCAGGCAGTGAGCTGACTTTCGGAGGCTATGACCCCTCTCATTTCTCTG

GGAGCCTCAACTGGATCCCAGTCACCAAGCAAGCCTATTGGCAGATTGCCCTGGATGG AATCCAGGTGGGAGACACTGTGATGTTCTGCTCCGAAGGCT

GCCAGGCCATAGTGGACACAGGGACCTCTCTCATCACTGGCCCCCCCGACAAGATCAAACAGCTTCAAGAGGCCATTGGGGCCACACCCATTGATGGAGA

A TATGCAGTGGATTGTGCCACTCTCGACACGATGCCAAACGTTACCTTCCTCATCAACGAGGTTTCATATACCCTCAACCCAACTGACTACATCCTGCC

G GACTTGGTGGAAGGAATGCAGTTCTGTGGCAGTGGCTTTCAAGGACTTGACATTCCACCTCCAGCTGGGCCCCTCTGGATCCTGGGGGATGTCTTCAT

CCGACAGTTCTACTCAGTCTTTGACCGTGGAAATAACCAAGTGGGATTGGCCCCCGCAGTTCCCTAAAGAGGGATGTATGCCTACATATGGATGCCTGAT

ACCCATTTAACCTGTTAGATACCTTTGTAACTATCAAAGCCGTCATTTCCCATGGGGTGTAGCCACCCCAGAGTATTCAGACCAATCAAAGCATAAGAGT

GCACCCCACTCACTGCAAACACACACACACACACACCACCTCTACCATCACCACGATGAAAGAAGTTCTGTCTATAGTCTTCACTGCTTATTGTTGACTT

TCTATTATGGAAATCTCTAAACATGTACACAGTAGACACGATGGCAAGATAAATACCCACACACCTCTGCCTCAGGTCACAACCCATCCATGTGTGGCCC

AGACTCTCTATCTTCCATCCCTCTGGTTCCACGCCTCTAGATTTGGAAGCAGATTCTAAGCACCAGGTCATTTTATCTAATGTCTAACATCCTTACAAAT

CAGAATTTAAATGTCTCACCCTCTCATAAATGTGGACCTGTTTTTACAGTTGGTTTATTTGTATCAGGATTAAAACCAGATCCATAACTGGACAAAAAAA

ACCCATAAACTGATTTGATTTT
Translation
MKPLLVLLLLLLLDLAQAQGALHR RVPLRRHQSLRKKLRAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEPLINYLD MEYFGTISIGTPPQNFTVIFD

TGSSNLWVPSVYCTSPACK KAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVS VEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLA

AGGVTPVFDNMMAQNLVALPMFSVYLSS SDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDG GIQVGDTVMFCSEGCQAIVDTGTSLITG

PPDKIKQLQEAIGATPIDGE YAVDCATLDTMPNVTFLINEVSYTLNPTDYILP DLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNN

QVGLAPAVP
Transcript ENSMUST00000073350
Sequence
CAACTTCATTTGTTCCTCAGAACTGCAGATGCCCTGTGTGACTCCAGAAGCGGTTAGAAAGATCAGGCGTGGTTATCTCCATTTGCAGCTGAGGTGGCCA

AGAGATAAGAGTTGCTTAAAGTCGGAGTTAGCAAACAACAAAACGGGGTTTCCACACAGAGCTCAGCTTCGGAGCCCAACCCATCCACTTACTACAAGAA

AACGAAATTCTTGACATTTTGGGTTATATCCGGTAACTTCAAAG - UNI34902 - ACTGGGCAGGGCAGGTCTGGGCACCAGGAAGAGCCAGTGCCC

CTGCCCTGTGATCAAGAGGAGAGAAGGGTGGAAGGGAGATCGGAGCAGAGTGAGAGAGAAGCTACCCCTTGGACCACAATGAAGCCCCTCCTTGTGCTGC

TGCTGCTGCTGCTCCTGGATCTGGCTCAGGCCCAAGGTGCTCTGCACAG AGTGCCCCTCAGAAGACATCAGTCCCTTCGGAAGAAACTACGGGCCCAAG

GACAGCTCTCAGAATTCTGGAGGTCTCATAACTTGGACATGACCCGACTCAGCGAGTCCTGTAATGTGTATTCGAGTGTCAATGAACCCCTCATCAACTA

CCTGGAT ATGGAATACTTTGGCACCATCTCCATCGGCACCCCGCCGCAGAACTTCACTGTCATCTTTGACACCGGTTCATCCAACCTCTGGGTCCCTTC

TGTGTACTGCACCAGCCCAGCATGCA AGGCACACCCAGTATTCCATCCATCGCAGTCCGACACATACACGGAGGTAGGGAATCATTTCTCCATCCAGTA

TGGTACCGGGAGCCTGACAGGAATCATTGGAGCTGATCAAGTCTCT GTGGAAGGGTTGACTGTGGATGGCCAGCAGTTTGGAGAAAGTGTCAAGGAGCC

AGGCCAGACCTTTGTGAATGCAGAGTTTGATGGGATTCTGGGTCTGGGATACCCCTCATTGGCTGCTGGAGGAGTGACCCCAGTGTTTGACAACATGATG

GCCCAGAACCTTGTGGCTCTGCCTATGTTTTCTGTCTACTTGAGCAG TGACCCTCAAGGTGGCTCAGGCAGTGAGCTGACTTTCGGAGGCTATGACCCC

TCTCATTTCTCTGGGAGCCTCAACTGGATCCCAGTCACCAAGCAAGCCTATTGGCAGATTGCCCTGGATGG AATCCAGGTGGGAGACACTGTGATGTTC

TGCTCCGAAGGCTGCCAGGCCATAGTGGACACAGGGACCTCTCTCATCACTGGCCCCCCCGACAAGATCAAACAGCTTCAAGAGGCCATTGGGGCCACAC

CCATTGATGGAGAA TATGCAGTGGATTGTGCCACTCTCGACACGATGCCAAACGTTACCTTCCTCATCAACGAGGTTTCATATACCCTCAACCCAACTG

ACTACATCCTGCCG GACTTGGTGGAAGGAATGCAGTTCTGTGGCAGTGGCTTTCAAGGACTTGACATTCCACCTCCAGCTGGGCCCCTCTGGATCCTGG

GGGATGTCTTCATCCGACAGTTCTACTCAGTCTTTGACCGTGGAAATAACCAAGTGGGATTGGCCCCCGCAGTTCCCTAAAGAGGGATGTATGCCTACAT

ATGGATGCCTGATACCCATTTAACCTGTTAGATACCTTTGTAACTATCAAAGCCGTCATTTCCCATGGGGTGTAGCCACCCCAGAGTATTCAGACCAATC

AAAGCATAAGAGTGCACCCCACTCACTGCAAACACACACACACACACACCACCTCTACCATCACCACGATGAAAGAAGTTCTGTCTATAGTCTTCACTGC

TTATTGTTGACTTTCTATTATGGAAATCTCTAAACATGTACACAGTAGACACGATGGCAAGATAAATACCCACACACCTCTGCCTCAGGTCACAACCCAT

CCATGTGTGGCCCAGACTCTCTATCTTCCATCCCTCTGGTTCCACGCCTCTAGATTTGGAAGCAGATTCTAAGCACCAGGTCATTTTATCTAATGTCTAA

CATCCTTACAAATCAGAATTTAAATGTCTCACCCTCTCATAAATGTGGACCTGTTTTTACAGTTGGTTTATTTGTATCAGGATTAAAACCAGATCCATAA

CTGGACAAAAAAAACCCATAAACTGATTTGATTTT
Translation
 - UNI34902 - MKPLLVLLLLLLLDLAQAQGALHR RVPLRRHQSLRKKLRAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEPLINYLD MEYFGTI

SIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACK KAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVS VEGLTVDGQQFGESVKEPGQTFVNA

EFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSS SDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDG GIQVGDTVMFCSEG

CQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGE YAVDCATLDTMPNVTFLINEVSYTLNPTDYILP DLVEGMQFCGSGFQGLDIPPPAGPLWILGDV

FIRQFYSVFDRGNNQVGLAPAVP

For any suggestions or comments, please send an email to unitrap@crg.es