Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004565 (Pnpla6)
Chromosomal location
Chr 8: 3515384 - 3544266 (+)
Description
patatin-like phospholipase domain containing 6 Gene [Source:MGI Symbol;Acc:MGI:1354723]
RefSeq_dna
NM_015801 
RefSeq_peptide
NP_056616.2 NP_001116290.1 
UniGene
Mm.23085 Mm.469608 
MGI
MGI:1354723 
Uniprot/SWISSPROT
Q3TRM4 
Human Ortholog
ENSG00000032444 (PNPLA6)
Omim 612020 - SPASTIC PARAPLEGIA 39, AUTOSOMAL RECESSIVE  
UniTrap UNI30840
Vector Insertion
Chr 8: 3517656 - 3521274
Public Clones IST14243D3 (tigm) IST11182E6 (tigm) IST13173D11 (tigm) IST14090A5 (tigm)
IST13786C3 (tigm) IST11257A1 (tigm) IST12082E10 (tigm) IST13650G7 (tigm)
IST10024G4 (tigm) IST11573C2 (tigm) IST10605F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35501
Vector Insertion
Chr 8: 3524330 - 3530961
Public Clones IST13412D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29988
Vector Insertion
Chr 8: 3531561 - 3531637
Public Clones D164C11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31330
Vector Insertion
Chr 8: 3532428 - 3534529
Public Clones IST14913D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36339
Vector Insertion
Chr 8: 3536003 - 3536542
Public Clones IST10893H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6432
Vector Insertion
Chr 8: 3537020 - 3537248
Public Clones CSA049 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37457
Vector Insertion
Chr 8: 3543177 - 3543953
Public Clones PST21347-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111070
Sequence
GTTGGCCGAAGCTGGGTGGACCTGGTTGCAGCTCCTGAATGGTACGAGTTTCCATCGACCGAGCAAAGGTGTCCCTTCGAGGACTGTTAGAGAGCTTCAG

CTTTGCCCCGGATCGATTTGTCCTGATTCCGG TACCCCTCTAGACGCTCTCACCCCAACCCCGGCGAATGGAGGAGTCACTCCAGCCAAAG GACTGCA

GGCTACAAGACCTGCTACCTAGTCCGAAACAATCGATGGAGGCCCCACTGCAAACCGGAATG GTGCTGGGCGTGATGATCGGGGCCGGAGTGGCGGTGC

TGGTCACCGCCGTGCTCATCCTCTTGGTGGTGCGAAGGCTGCGGGTGCAGA AAACTCCAGCCCCGGAGGGTCCCCGGTATCGGTTCCGGAAGCGGGACA

AAGTGCTTTTCTATGGCCGGAAGATTATGCGGAAG GTGTCACAGTCCACTTCTTCCCTGGTGGACACATCAGTCTCCACCACTTCCCGGCCCCGCATGA

AGAAGAAACTGAAGATGCTTAACATTGCCAAGAA - UNI30840 - GATCTTACGTATCCAAAAGGAGACTCCGACCCTACAACGGAAGGAGCCCCCA

CCTTCAGTGCTGGAGGCTGACCTCACAGAGGGAGACCTGGCCAATTCCCACCTACCCTCTGAGGTACTCTACATGCTTAAGAATGTTCG GGTGCTAGGT

CACTTTGAGAAGCCGCTCTTCCTGGAGCTCTGCCGGCACATGGTCTTCCAGCGTCTCGGGCAGGGGGACTATGTTTTTCGGCCCGGTCAACCAGATGCCA

GCATCTATGTGGTTCAAGATGGGCTGCTGGAGCTCTGCCTACCAGGGCCT GATGGGAAGGAGTGTGTGGTGAAGGAGGTGGTTCCTGGAGACAGCGTCA

ACAGCCTTCTGAGCATCCTTGATGTCATCACG GGTCACCAGCATCCCCAGCGGACTGTGTCAGCCAGGGCTGCACGGGACTCCACAGTGCTGAGACTCC

CAGTAGAAGCCTTCTCTGCTGTCTTCACCAAGTACCCTGAGAGTTTGGTGCGAGTGGTACAG ATCATCATGGTAAGGCTGCAGAGAGTCACCTTCCTGG

CGCTTCACAATTACCTGGGTCTGACCAATGAACTCTTCAGTCAT GAGATCCAGCCCCTACGCCTTTTCCCCAGCCCCGGCCTCCCGACCCGAACCAGCC

CTGTCCGTGGCTCTAAACGGGTAGTCAGCACCTCAGGTACTGAGGACACCTCAAAGGAGACCTCTGGCCGGCCCCTGGACTCCATTGGAGCTCCTCTGCC

TGGACCTGCAG GGGATCCCGTGAAGCCCACATCCTTAGAAGCACCCCCAGCCCCGTTACTGAGCCGCTGCATCTCCATGCCAGTAGACATCTCAG GCT

TGCAAGGTGGCCCTCGTTCTGATTTTGACATGGCCTATGAACGTGGACGGATATCTGTTTCTCTTCAAGAAGAGGCATCTGGGGGACCTCAGACAGCATC

CCCTAGG ACCCCCACTCAGGAGCTCCGGGAGCAGCCAGCGGGTGCCTGTGAATATAGCTACTGTGAGGATGAGTCAGCCACAGGCGGATGTCCCTTTGG

GCCCTACCAGGGCCGCCAGACAAGCAGCATCTTTGAGGCTGCAAAGAGAGAGCTAGCCAAGCTGATGCGGATTGAG GACCCCTCTCTACTGAACAGCAG

AGTCTTGCTACATCATGCCAAAGCCGGCACCATCATAGCCCGCCAAGGGGACCAG GATGTGAGCCTGCACTTTGTGCTCTGGGGCTGCCTGCACGTGTA

CCAGCGCATGATTGACAAGGCTGAGGAAGTGTGCCTATTTGTGGCACAGCCAGGGGAGCTGGTGGGGCAACTGGCGGTGCTCACTGGGGAACCTCTCATC

TTCACACTACGTGCCCAGAGAGACTGCACCTTCCTGCGGATCTCCAAATCCCACTTCTATGA GATCATGCGTGCACAACCCAGTGTGGTACTGAGTGCA

GCTCACACGGTGGCTGCTAGAATGTCCCCCTTCGTGCGCCAGATGGACTTTGCCATTGACTGGACAGCTGTGGAGGCTGGTCGTGCGCTCTACAG - UN

I29988 - GCAGGGAGACCGCTCCGACTGCACCTACATTGTACTCAATGGACGTCTCCGTAGTGTCATCCAACGAGGCAGTGGCAAGAAGGAGCTAGTT

GGGGAGTATGGTCGAGGGGATCTCATTGGCGTG GTGGAGGCACTGACCCGGCAGCCACGAGCCACCACTGTACACGCAGTGCGAGACACTGAGCTGGCC

AAGCTTCCCGAGGGCACCTTAGGCCACATCAAACGTCGGTACCCACAG GTTGTGACCCGCCTTATTCATCTGCTAAGCCAGAAAATTCTAGGCAATCTG

CAGCAGTTGCAAGGACCCTTTCCAG - UNI31330 - GCTCCGGGCTCAGTGTTCCGCAGCACTCGGAACTGACCAACCCAGCCAGCAATCTGTCTAC

TGTAGCTATCCTCCCTGTGTGTGCTGAGGTGCCCATGATGGCCTTTACTCTGGAACTGCAGCATGCTCTGCAAGCTATTG GTCCCACGCTCCTCCTTAA

CAGTGACGTCATCCGGGCACTCCTGGGGGCTTCAGCACTGGATAG CATTCAAGAATTCCGGCTGTCAGGGTGGTTGGCCCAGCAGGAAGATGCCCATCG

CATTGTGCTCTACCAAACTGACACATCCCTGACGCCTTGGACCGTCCGTTGTCTGCGCCAGGCCGACTGCATCCTCATTGTGGGCCTGGGGGACCAGGAA

CCCACTGTTGGCCAG CTGGAGCAAATGTTAGAGAACACTGCTGTCCGTGCCTTGAAGCAACTGGTTTTGCTGCACCGGGAGGAAGGCCCTGGTCCCACG

CGCACTGTAGAGTGGCTCAACATGCGCAGCTGGTGCTCAGGGCACCTGCACCTGCGCTGTCCTCGCCGCCTCTTCTCACGGCGCAGCCCAGCGAAACTT 

CATGAGCTGTATGAGAAGGTTTTCTCCAGGCGTGCAGACCGTCACAGCGACTTCTCCCGCTTGGCACGAGTACTCACAGGAAACACTATTGCTCTGGTGC

TGGGTGGGGGCGGAGCCAG AGGCTGCTCGCATATTGGGGTGCTGAAGGCATTAGAGGAGGCAGGAGTCCCAGTCGACCTTGTGGGAGGCACATCCATAG

GTTCCTTCATTGGGGCCTTGTATGCCGAGGAACGCAGCGCCAGCCGAACTAAACAACGAGCCCGGGAGTGGGCCAAG - UNI6432 - AGCATGACTT

CTGTACTGGAGCCTGTATTGGACCTCACATATCCTGTCACCTCCATGTTTACTGGCTCAGCCTTTAACAGAAGTATCCACCGTGTCTTCCAGGATAAGCA

GATTGAG GACCTGTGGCTGCCTTACTTCAATGTGACCACAGACATCACTGCCTCTGCCATGCGCGTCCACAAAGATG GCTCCCTGTGGCGGTATGTAC

GTGCCAGCATGACGCTCTCGGGCTACCTACCCCCGCTGTGCGACCCAAAGGATGGGCACCTGCTCATGGATGGTGGCTACATCAACAACCTGCCAG CGG

ATATTGCCCGAAGCATGGGAGCCAAAACGGTCATTGCCATCGACGTTGGAAGCCAGGATGAGACAGATCTCAGCACCTATGGGGACAGCCTGTCTGGCTG

GTGGTTGCTGTGGAAAAGGCTAAACCCCTGGGCAGACAAGGTAAAGGTTCCAGACATGGCTGAGATCCAGTCCCGCTTGGCGTACGTGTCCTGTGTGCGG

CAGCTAGAAGTCGTCAAGTCCAGCTCCTATTGCGAGTACCTTCGTCCATCCATTGACTGCTTCAAGACCATGGACTTTGGAAAGTTTGACCAGATCTAT 

GATGTGGGTTACCAGTATGGGAAGGCTGTCTTTGGAGGCTGGACCCGTGGTGAAGTCATTGAGAAAATGCTCACAGACCGGAGATCTACAGACCTTAATG

AGAGTCGCCGTGCAGAT ATACTTGCCTTCCCAAGTTCTGGGTTCACTGACTTGGCTGAGATTGTGTCCCGGATCGAGCCACCAACAAGCTACGTCTCTG

ATGGCTGTGCTGATG GGGAGGAGTCGGATTGCTTGACAGAGTATGAGGAAGATGCAGGACCAGACTGCTCAAGAGATGAAGGGGGCTCCCCTGAGGGTG

CCAGCCCTAGCACTGCCTCAGAGGTG GAAGAAGAGAAGTCCACACTCCGGCAACGACGCTTTCTGCCTCAGGAGACTCCCAGCTCAGTCGCAGATGCCT

GAGGATCTTGACAGGGAAGCCCTGTTCCTAGACTGGGTTATGGGTGAGCTTGTGGGGGAGCTCACACTATTATTCCCACTGCTGCTATACTTCAACACTC

CCTGGGCCCTTCCCCCTTGGCTCCAAGGACCACACACTGGACTGACTTGCCCTGTCCCTAAGGGGAGGGCAGAACTGCACTGATAACCTTTGACCAACTA

TGTGACCTTCCCCCAAATAAACTCTTACCCCTTTCGAAGC
Translation
  MEAPLQTGM VLGVMIGAGVAVLVTAVLILLVVRRLRVQK KTPAPEGPRYRFRKRDKVLFYGRKIMRK VSQSTSSLVDTSVSTTSRPRMKKKLKML

NIAKK - UNI30840 - KILRIQKETPTLQRKEPPPSVLEADLTEGDLANSHLPSEVLYMLKNVR RVLGHFEKPLFLELCRHMVFQRLGQGDYVFRP

GQPDASIYVVQDGLLELCLPGP DGKECVVKEVVPGDSVNSLLSILDVIT GHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQ IIMVR

LQRVTFLALHNYLGLTNELFSH EIQPLRLFPSPGLPTRTSPVRGSKRVVSTSGTEDTSKETSGRPLDSIGAPLPGPAG GDPVKPTSLEAPPAPLLSRC

ISMPVDISG GLQGGPRSDFDMAYERGRISVSLQEEASGGPQTASPR TPTQELREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKRELAKL

MRIE DPSLLNSRVLLHHAKAGTIIARQGDQ DVSLHFVLWGCLHVYQRMIDKAEEVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSHFY

E EIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYR - UNI29988 - RQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDL

IGV VEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRYPQ VVTRLIHLLSQKILGNLQQLQGPFPG - UNI31330 - GSGLSVPQHSELTNPAS

NLSTVAILPVCAEVPMMAFTLELQHALQAIG GPTLLLNSDVIRALLGASALDS SIQEFRLSGWLAQQEDAHRIVLYQTDTSLTPWTVRCLRQADCILI

VGLGDQEPTVGQ LEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKL HELYEKVFSRRADRHSDFSRLARVL

TGNTIALVLGGGGAR RGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQRAREWAK - UNI6432 - SMTSVLEPVLDLTYPVTS

MFTGSAFNRSIHRVFQDKQIE DLWLPYFNVTTDITASAMRVHKDG GSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPA ADIARSMGAKTV

IAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPSIDCFKTMDFGKFDQIY DVGYQYGKAV

FGGWTRGEVIEKMLTDRRSTDLNESRRAD ILAFPSSGFTDLAEIVSRIEPPTSYVSDGCADG GEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASE

V EEEKSTLRQRRFLPQETPSSVADA
Transcript ENSMUST00000004681
Sequence
AAAGGTGCCGCGTCTGAGGCAGCGGGCAGAAAACTAGGGGTGTTGGCCGAAGCTGGGTGGACCTGGTTGCAGCTCCTGAATGGTACGAGTTTCCATCGAC

CGAGCAAAGGTGTCCCTTCGAGGACTGTTAGAGAGCTTCAGCTTTGCCCCGGATCGATTTGTCCTGATTCCGG GACTGCAGGCTACAAGACCTGCTACC

TAGTCCGAAACAATCGATGGAGGCCCCACTGCAAACCGGAATG GTGCTGGGCGTGATGATCGGGGCCGGAGTGGCGGTGCTGGTCACCGCCGTGCTCAT

CCTCTTGGTGGTGCGAAGGCTGCGGGTGCAGA AAACTCCAGCCCCGGAGGGTCCCCGGTATCGGTTCCGGAAGCGGGACAAAGTGCTTTTCTATGGCCG

GAAGATTATGCGGAAG GTGTCACAGTCCACTTCTTCCCTGGTGGACACATCAGTCTCCACCACTTCCCGGCCCCGCATGAAGAAGAAACTGAAGATGCT

TAACATTGCCAAGAA - UNI30840 - GATCTTACGTATCCAAAAGGAGACTCCGACCCTACAACGGAAGGAGCCCCCACCTTCAGTGCTGGAGGCTG

ACCTCACAGAGGGAGACCTGGCCAATTCCCACCTACCCTCTGAGGTACTCTACATGCTTAAGAATGTTCG GGTGCTAGGTCACTTTGAGAAGCCGCTCT

TCCTGGAGCTCTGCCGGCACATGGTCTTCCAGCGTCTCGGGCAGGGGGACTATGTTTTTCGGCCCGGTCAACCAGATGCCAGCATCTATGTGGTTCAAGA

TGGGCTGCTGGAGCTCTGCCTACCAGGGCCT GATGGGAAGGAGTGTGTGGTGAAGGAGGTGGTTCCTGGAGACAGCGTCAACAGCCTTCTGAGCATCCT

TGATGTCATCACG GGTCACCAGCATCCCCAGCGGACTGTGTCAGCCAGGGCTGCACGGGACTCCACAGTGCTGAGACTCCCAGTAGAAGCCTTCTCTGC

TGTCTTCACCAAGTACCCTGAGAGTTTGGTGCGAGTGGTACAG ATCATCATGGTAAGGCTGCAGAGAGTCACCTTCCTGGCGCTTCACAATTACCTGGG

TCTGACCAATGAACTCTTCAGTCAT GAGATCCAGCCCCTACGCCTTTTCCCCAGCCCCGGCCTCCCGACCCGAACCAGCCCTGTCCGTGGCTCTAAACG

GGTAGTCAGCACCTCAGGTACTGAGGACACCTCAAAGGAGACCTCTGGCCGGCCCCTGGACTCCATTGGAGCTCCTCTGCCTGGACCTGCAG GGGATCC

CGTGAAGCCCACATCCTTAGAAGCACCCCCAGCCCCGTTACTGAGCCGCTGCATCTCCATGCCAGTAGACATCTCAG GCTTGCAAGGTGGCCCTCGTTC

TGATTTTGACATGGCCTATGAACGTGGACGGATATCTGTTTCTCTTCAAGAAGAGGCATCTGGGGGACCTCAGACAGCATCCCCTAGG ACCCCCACTCA

GGAGCTCCGGGAGCAGCCAGCGGGTGCCTGTGAATATAGCTACTGTGAGGATGAGTCAGCCACAGGCGGATGTCCCTTTGGGCCCTACCAGGGCCGCCAG

ACAAGCAGCATCTTTGAGGCTGCAAAGAGAGAGCTAGCCAAGCTGATGCGGATTGAG GACCCCTCTCTACTGAACAGCAGAGTCTTGCTACATCATGCC

AAAGCCGGCACCATCATAGCCCGCCAAGGGGACCAG GATGTGAGCCTGCACTTTGTGCTCTGGGGCTGCCTGCACGTGTACCAGCGCATGATTGACAAG

GCTGAGGAAGTGTGCCTATTTGTGGCACAGCCAGGGGAGCTGGTGGGGCAACTGGCGGTGCTCACTGGGGAACCTCTCATCTTCACACTACGTGCCCAGA

GAGACTGCACCTTCCTGCGGATCTCCAAATCCCACTTCTATGA GATCATGCGTGCACAACCCAGTGTGGTACTGAGTGCAGCTCACACGGTGGCTGCTA

GAATGTCCCCCTTCGTGCGCCAGATGGACTTTGCCATTGACTGGACAGCTGTGGAGGCTGGTCGTGCGCTCTACAG - UNI29988 - GCAGGGAGAC

CGCTCCGACTGCACCTACATTGTACTCAATGGACGTCTCCGTAGTGTCATCCAACGAGGCAGTGGCAAGAAGGAGCTAGTTGGGGAGTATGGTCGAGGGG

ATCTCATTGGCGTG GTGGAGGCACTGACCCGGCAGCCACGAGCCACCACTGTACACGCAGTGCGAGACACTGAGCTGGCCAAGCTTCCCGAGGGCACCT

TAGGCCACATCAAACGTCGGTACCCACAG GTTGTGACCCGCCTTATTCATCTGCTAAGCCAGAAAATTCTAGGCAATCTGCAGCAGTTGCAAGGACCCT

TTCCAG - UNI31330 - GCTCCGGGCTCAGTGTTCCGCAGCACTCGGAACTGACCAACCCAGCCAGCAATCTGTCTACTGTAGCTATCCTCCCTGTG

TGTGCTGAGGTGCCCATGATGGCCTTTACTCTGGAACTGCAGCATGCTCTGCAAGCTATTG GTCCCACGCTCCTCCTTAACAGTGACGTCATCCGGGCA

CTCCTGGGGGCTTCAGCACTGGATAG CATTCAAGAATTCCGGCTGTCAGGGTGGTTGGCCCAGCAGGAAGATGCCCATCGCATTGTGCTCTACCAAACT

GACACATCCCTGACGCCTTGGACCGTCCGTTGTCTGCGCCAGGCCGACTGCATCCTCATTGTGGGCCTGGGGGACCAGGAACCCACTGTTGGCCAG CTG

GAGCAAATGTTAGAGAACACTGCTGTCCGTGCCTTGAAGCAACTGGTTTTGCTGCACCGGGAGGAAGGCCCTGGTCCCACGCGCACTGTAGAGTGGCTCA

ACATGCGCAGCTGGTGCTCAGGGCACCTGCACCTGCGCTGTCCTCGCCGCCTCTTCTCACGGCGCAGCCCAGCGAAACTT CATGAGCTGTATGAGAAGG

TTTTCTCCAGGCGTGCAGACCGTCACAGCGACTTCTCCCGCTTGGCACGAGTACTCACAGGAAACACTATTGCTCTGGTGCTGGGTGGGGGCGGAGCCAG

 AGGCTGCTCGCATATTGGGGTGCTGAAGGCATTAGAGGAGGCAGGAGTCCCAGTCGACCTTGTGGGAGGCACATCCATAGGTTCCTTCATTGGGGCCTT

GTATGCCGAGGAACGCAGCGCCAGCCGAACTAAACAACGAGCCCGGGAGTGGGCCAAG - UNI6432 - AGCATGACTTCTGTACTGGAGCCTGTATT

GGACCTCACATATCCTGTCACCTCCATGTTTACTGGCTCAGCCTTTAACAGAAGTATCCACCGTGTCTTCCAGGATAAGCAGATTGAG GACCTGTGGCT

GCCTTACTTCAATGTGACCACAGACATCACTGCCTCTGCCATGCGCGTCCACAAAGATG GCTCCCTGTGGCGGTATGTACGTGCCAGCATGACGCTCTC

GGGCTACCTACCCCCGCTGTGCGACCCAAAGGATGGGCACCTGCTCATGGATGGTGGCTACATCAACAACCTGCCAG CGGATATTGCCCGAAGCATGGG

AGCCAAAACGGTCATTGCCATCGACGTTGGAAGCCAGGATGAGACAGATCTCAGCACCTATGGGGACAGCCTGTCTGGCTGGTGGTTGCTGTGGAAAAGG

CTAAACCCCTGGGCAGACAAGGTAAAGGTTCCAGACATGGCTGAGATCCAGTCCCGCTTGGCGTACGTGTCCTGTGTGCGGCAGCTAGAAGTCGTCAAGT

CCAGCTCCTATTGCGAGTACCTTCGTCCATCCATTGACTGCTTCAAGACCATGGACTTTGGAAAGTTTGACCAGATCTAT GATGTGGGTTACCAGTATG

GGAAGGCTGTCTTTGGAGGCTGGACCCGTGGTGAAGTCATTGAGAAAATGCTCACAGACCGGAGATCTACAGACCTTAATGAGAGTCGCCGTGCAGAT A

TACTTGCCTTCCCAAGTTCTGGGTTCACTGACTTGGCTGAGATTGTGTCCCGGATCGAGCCACCAACAAGCTACGTCTCTGATGGCTGTGCTGATG GGG

AGGAGTCGGATTGCTTGACAGAGTATGAGGAAGATGCAGGACCAGACTGCTCAAGAGATGAAGGGGGCTCCCCTGAGGGTGCCAGCCCTAGCACTGCCTC

AGAGGTG GAAGAAGAGAAGTCCACACTCCGGCAACGACGCTTTCTGCCTCAGGAGACTCCCAGCTCAGTCGCAGATGCCTGAGGATCTTGACAGGGAAG

CCCTGTTCCTAGACTGGGTTATGGGTGAGCTTGTGGGGGAGCTCACACTATTATTCCCACTGCTGCTATACTTCAACACTCCCTGGGCCCTTCCCCCTTG

GCTCCAAGGACCACACACTGGACTGACTTGCCCTGTCCCTAAGGGGAGGGCAGAACTGCACTGATAACCTTTGACCAACTATGTGACCTTCCCCCAAATA

AACTCTTACCCCTTTCGAAGC
Translation
 MEAPLQTGM VLGVMIGAGVAVLVTAVLILLVVRRLRVQK KTPAPEGPRYRFRKRDKVLFYGRKIMRK VSQSTSSLVDTSVSTTSRPRMKKKLKMLN

IAKK - UNI30840 - KILRIQKETPTLQRKEPPPSVLEADLTEGDLANSHLPSEVLYMLKNVR RVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPG

QPDASIYVVQDGLLELCLPGP DGKECVVKEVVPGDSVNSLLSILDVIT GHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQ IIMVRL

QRVTFLALHNYLGLTNELFSH EIQPLRLFPSPGLPTRTSPVRGSKRVVSTSGTEDTSKETSGRPLDSIGAPLPGPAG GDPVKPTSLEAPPAPLLSRCI

SMPVDISG GLQGGPRSDFDMAYERGRISVSLQEEASGGPQTASPR TPTQELREQPAGACEYSYCEDESATGGCPFGPYQGRQTSSIFEAAKRELAKLM

RIE DPSLLNSRVLLHHAKAGTIIARQGDQ DVSLHFVLWGCLHVYQRMIDKAEEVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSHFYE

 EIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYR - UNI29988 - RQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLI

GV VEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRYPQ VVTRLIHLLSQKILGNLQQLQGPFPG - UNI31330 - GSGLSVPQHSELTNPASN

LSTVAILPVCAEVPMMAFTLELQHALQAIG GPTLLLNSDVIRALLGASALDS SIQEFRLSGWLAQQEDAHRIVLYQTDTSLTPWTVRCLRQADCILIV

GLGDQEPTVGQ LEQMLENTAVRALKQLVLLHREEGPGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKL HELYEKVFSRRADRHSDFSRLARVLT

GNTIALVLGGGGAR RGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSASRTKQRAREWAK - UNI6432 - SMTSVLEPVLDLTYPVTSM

FTGSAFNRSIHRVFQDKQIE DLWLPYFNVTTDITASAMRVHKDG GSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPA ADIARSMGAKTVI

AIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPSIDCFKTMDFGKFDQIY DVGYQYGKAVF

GGWTRGEVIEKMLTDRRSTDLNESRRAD ILAFPSSGFTDLAEIVSRIEPPTSYVSDGCADG GEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEV

 EEEKSTLRQRRFLPQETPSSVADA

For any suggestions or comments, please send an email to unitrap@crg.es