Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004567 (Mcoln1)
Chromosomal location
Chr 8: 3500508 - 3515229 (+)
Description
mucolipin 1 Gene [Source:MGI (curated);Acc:Mcoln1]
RefSeq_dna
NM_053177 
RefSeq_peptide
NP_444407.1 
MGI
MGI:1890498 
Uniprot/SWISSPROT
Q99J21 
Human Ortholog
ENSG00000090674 (MCOLN1)
Omim 252650 - MUCOLIPIDOSIS IV  
UniTrap UNI14543
Vector Insertion
Chr 8: 3500628 - 3505737
Public Clones FHCRC-GT-S6-9B1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111076
Sequence
GGGTTTGAAGCGGCGCCGGGAGGGAGCGAGGCTGCAGTGACCGCGGCGCGCGCTGGGACCCACCCGCGTCTCGCGCTCACCCTGCGGCCATGGCCACCCC

GGCGGGCCGGCGCGCCTCAG - UNI14543 - AGACTGAGCGGCTGCTGACCCCCAATCCTGGGTATGGGACCCAGGTGGGGACCTCACCAGCCCCAA

CAACCCCCACAGAAGAGGAAGACCTCCGCCGCCGCCTCAAGTACTTCTTTATGAGCCCATGTGACAAGTTCCGGGCCAAAGGCCGCAAGCCCTGCAAGCT

GATGCTGCAGGTGGTCAAGATCTTGGTGGTCACTGTGCAG CTCATTCTCTTTGGGCTCAGCAACCAGCTGGTGGTGACATTCCGGGAAGAGAACACCAT

TGCCTTCCGACATCTCTTCCTGCTGGGTTACTCTGATGGGTCTGATGACACCTTTGCAGCCTACACACAGGAGCAGCTCTACCAAGCCATCTTCTATGCT

GTGGACCAG TACCTGATACTACCTGAGATATCCCTGGGCCGGTATGCCTATGTCCGTGGTGGGGGTGGGCCTTGGGCCAATGGATCAGCTTTGGCTCTC

TGCCAGCGGTACTACCACCGTGGCCATGTGGACCCAGCCAATGATACCTTTGACATTGATCCAAGGGTAGTCACTG ACTGTATCCAGGTGGATCCTCCT

GACAGACCCCCTGACATCCCCAGTGAGGACTTGGACTTCTTGGATGGCAGCGCCAGTTACAAGAACCTCACACTGAAATTCCACAA GCTGATCAACGTC

ACCATCCACTTCCAGCTGAAGACAATTAACCTGCAGAGCCTCATCAACAATGAGATCCCTGATTGTTACACCTTCAGTATCCTG ATCACATTTGACAAT

AAAGCGCACAGTGGGCGAATCCCCATCCGCCTGGAGACCAAGACCCACATCCAGGAGTGCAAACACCCCAGTGTCTCCAGACATG GAGACAACAGCTTC

CGGCTTCTGTTTGATGTGGTGGTTATCCTCACCTGCTCCCTGTCCTTCCTGCTGTGCGCCCGCTCACTGCTCCGTGGCTTCCTGCTGCAGAAC GAGTTT

GTTGTATTCATGTGGCGGCGGCGGGGTCGGGAAATCAGCCTCTGGGAACGGCTGGAGTTTGTCAATGGCTGGTACATCCTGCTGGTCACCAGTGACGTGC

TCACCATCTCGGGGACTGTCATGAAGATTGGCATTGAGGCAAAG AACCTAGCCAGCTATGATGTCTGCAGTATTCTCTTGGGTACCTCCACTCTGCTAG

TCTGGGTCGGTGTCATTCGCTACCTGACATTTTTCCACAAGTACAAC ATCTTGATTGCCACGTTGCGAGTGGCACTGCCCAGTGTCATGCGTTTCTGCT

GCTGTGTGGCTGTCATCTACCTGGGCTATTGCTTCTGTGGCTGGATCGTTCTAGGGCCCTACCATGTGAAG TTCCGCTCGCTGTCCATGGTTTCTGAGT

GTCTGTTCTCACTCATCAACGGAGACGACATGTTTGTGACGTTCGCGGCCATGCAGGCCCAGCAGGGTCACAGCAGCCTGGTGTGGCTCTTCTCCCAGCT

GTACCTCTACTCCTTCATCAGCCTCTTCATCTACATGGTGCTGAGCCTCTTCATTGCACTCATCACCGGCGCCTATGACACCATCAAG AGGACAAACCA

CAGGAATTGGTTCTCCTCCTTCACTGTATGGATCATAGATCTGAACACAAGTTACCAGCTTTGCAGCAAGTGCCTTTACCTGCCACACCATCTCACTGGC

TTCCTCCCTCTCTCATACCATCTTTTATTAAAAACCATTTACTTATTTAGGGGTGAGAGGAGGTTGTGCACAGCACAGTGTGTTTGGAAATTAGAGACGA

CTTGTGGAAATCAGCTCTCTTCGTCCACCATGTGGAGTCATCAGGTTTGA
Translation
MATPAGRRASE - UNI14543 - ETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQ LILFG

LSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAYTQEQLYQAIFYAVDQ YLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFD

IDPRVVTD DCIQVDPPDRPPDIPSEDLDFLDGSASYKNLTLKFHK KLINVTIHFQLKTINLQSLINNEIPDCYTFSIL ITFDNKAHSGRIPIRLETK

THIQECKHPSVSRHG GDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQN EFVVFMWRRRGREISLWERLEFVNGWYILLVTSDVLTISGTVMKIGI

EAK NLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYN ILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVK FRSLSMVSECLFSLINGDD

MFVTFAAMQAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIK RTNHRNWFSSFTVWIIDLNTSYQLCSKCLYLPHHLTGFLPLSYHLL

LKTIYLFRGERRLCTAQCVWKLETTCGNQLSSSTMWSHQV
Transcript ENSMUST00000004683
Sequence
GGGTTTGAAGCGGCGCCGGGAGGGAGCGAGGCTGCAGTGACCGCGGCGCGCGCTGGGACCCACCCGCGTCTCGCGCTCACCCTGCGGCCATGGCCACCCC

GGCGGGCCGGCGCGCCTCAG - UNI14543 - AGACTGAGCGGCTGCTGACCCCCAATCCTGGGTATGGGACCCAGGTGGGGACCTCACCAGCCCCAA

CAACCCCCACAGAAGAGGAAGACCTCCGCCGCCGCCTCAAGTACTTCTTTATGAGCCCATGTGACAAGTTCCGGGCCAAAGGCCGCAAGCCCTGCAAGCT

GATGCTGCAGGTGGTCAAGATCTTGGTGGTCACTGTGCAG CTCATTCTCTTTGGGCTCAGCAACCAGCTGGTGGTGACATTCCGGGAAGAGAACACCAT

TGCCTTCCGACATCTCTTCCTGCTGGGTTACTCTGATGGGTCTGATGACACCTTTGCAGCCTACACACAGGAGCAGCTCTACCAAGCCATCTTCTATGCT

GTGGACCAG TACCTGATACTACCTGAGATATCCCTGGGCCGGTATGCCTATGTCCGTGGTGGGGGTGGGCCTTGGGCCAATGGATCAGCTTTGGCTCTC

TGCCAGCGGTACTACCACCGTGGCCATGTGGACCCAGCCAATGATACCTTTGACATTGATCCAAGGGTAGTCACTG ACTGTATCCAGGTGGATCCTCCT

GACAGACCCCCTGACATCCCCAGTGAGGACTTGGACTTCTTGGATGGCAGCGCCAGTTACAAGAACCTCACACTGAAATTCCACAA GCTGATCAACGTC

ACCATCCACTTCCAGCTGAAGACAATTAACCTGCAGAGCCTCATCAACAATGAGATCCCTGATTGTTACACCTTCAGTATCCTG ATCACATTTGACAAT

AAAGCGCACAGTGGGCGAATCCCCATCCGCCTGGAGACCAAGACCCACATCCAGGAGTGCAAACACCCCAGTGTCTCCAGACATG GAGACAACAGCTTC

CGGCTTCTGTTTGATGTGGTGGTTATCCTCACCTGCTCCCTGTCCTTCCTGCTGTGCGCCCGCTCACTGCTCCGTGGCTTCCTGCTGCAGAAC GAGTTT

GTTGTATTCATGTGGCGGCGGCGGGGTCGGGAAATCAGCCTCTGGGAACGGCTGGAGTTTGTCAATGGCTGGTACATCCTGCTGGTCACCAGTGACGTGC

TCACCATCTCGGGGACTGTCATGAAGATTGGCATTGAGGCAAAG AACCTAGCCAGCTATGATGTCTGCAGTATTCTCTTGGGTACCTCCACTCTGCTAG

TCTGGGTCGGTGTCATTCGCTACCTGACATTTTTCCACAAGTACAAC ATCTTGATTGCCACGTTGCGAGTGGCACTGCCCAGTGTCATGCGTTTCTGCT

GCTGTGTGGCTGTCATCTACCTGGGCTATTGCTTCTGTGGCTGGATCGTTCTAGGGCCCTACCATGTGAAG TTCCGCTCGCTGTCCATGGTTTCTGAGT

GTCTGTTCTCACTCATCAACGGAGACGACATGTTTGTGACGTTCGCGGCCATGCAGGCCCAGCAGGGTCACAGCAGCCTGGTGTGGCTCTTCTCCCAGCT

GTACCTCTACTCCTTCATCAGCCTCTTCATCTACATGGTGCTGAGCCTCTTCATTGCACTCATCACCGGCGCCTATGACACCATCAAG CACCCAGGAGG

TACTGGCACAGAGAAGAGTGAGCTCCAGGCCTACATCGAGCAGTGCCAGGATAGCCCCACATCTGGCAAGTTCCGTCGTGGCAGTGGCTCAGCTTGTAGC

CTTTTCTGCTGCTGTGGAAG GGACTCCCCGGAGGACCATTCGCTGCTGGTGAACTGATCCAAGATGATTGCCACTAGACTTTATCCCCATGTACTGCTG

GGACCCCAGCTTATTTATTTTTAGAATTTGCTTTAAAAGATCTGCGTCTGACAGGCCTTGTGAGGGCTTGGGCTGATCGAATCGGACACAGGGGAAAGGG

AGGGCATGTAGGGCGGCTGTTAAATAAAAGGGAATGT
Translation
MATPAGRRASE - UNI14543 - ETERLLTPNPGYGTQVGTSPAPTTPTEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQ LILFG

LSNQLVVTFREENTIAFRHLFLLGYSDGSDDTFAAYTQEQLYQAIFYAVDQ YLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFD

IDPRVVTD DCIQVDPPDRPPDIPSEDLDFLDGSASYKNLTLKFHK KLINVTIHFQLKTINLQSLINNEIPDCYTFSIL ITFDNKAHSGRIPIRLETK

THIQECKHPSVSRHG GDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQN EFVVFMWRRRGREISLWERLEFVNGWYILLVTSDVLTISGTVMKIGI

EAK NLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYN ILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVK FRSLSMVSECLFSLINGDD

MFVTFAAMQAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIK HPGGTGTEKSELQAYIEQCQDSPTSGKFRRGSGSACSLFCCCGR R

DSPEDHSLLVN

For any suggestions or comments, please send an email to unitrap@crg.es