Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004591 (Pkn2)
Chromosomal location
Chr 3: 142456266 - 142516848 (-)
Description
protein kinase N2 Gene [Source:MGI Symbol;Acc:MGI:109211]
RefSeq_peptide
NP_848769.1 
UniGene
Mm.244236 Mm.398767 
MGI
MGI:109211 
Uniprot/SWISSPROT
Q8BWW9 
Uniprot/SPTREMBL
Q3TBR3 Q8BJM4 Q8BL62 Q8BW55 
Human Ortholog
ENSG00000065243 (PKN2)
Omim not available
UniTrap UNI20416
Vector Insertion
Chr 3: 142516627 - 142516679
Public Clones not available
Private Clones OST364044 (lexicon) OST311799 (lexicon) OST67432 (lexicon) OST64778 (lexicon)
OST57107 (lexicon) OST44685 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38643
Vector Insertion
Chr 3: 142516627 - 142516849
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4993
Vector Insertion
Chr 3: 142516377 - 142516598
Public Clones YTC386 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2138
Vector Insertion
Chr 3: 142493579 - 142502171
Public Clones AD0653 (sanger) XP0145 (sanger) AB0292 (sanger) AD0652 (sanger)
AB0293 (sanger) XT0507 (sanger) XA059 (baygenomics) XB006BC (baygenomics)
Private Clones OST95936 (lexicon) OST41490 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18809
Vector Insertion
Chr 3: 142484669 - 142491844
Public Clones not available
Private Clones OST413776 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1197
Vector Insertion
Chr 3: 142475022 - 142483500
Public Clones CE0149 (sanger) RRF388 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6496
Vector Insertion
Chr 3: 142462010 - 142462768
Public Clones YHC339 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4858
Vector Insertion
Chr 3: 142457460 - 142461866
Public Clones AF0627 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043812
Sequence
ATACAG - UNI20416 - GGAGATTCCCGGACTCTTCCATTTTCTGAGAATGTGAGTGCTGTTCAGAAATTAGACTTTTCAGATACAATGGTGCAACA

GAAATTGGACGACATCAAGGATCGAATAAAGAGAGAAATAAGGAAAGAACTGAAAATCAAAGAAGGAGCTGAAAACCTGAGGAAAGTTACAACAGATAAG

AAAAATTTGGCTTATGTAGACAACATTTTGAAAAAATCAAATAAAAAATTAGAAGAATTACATCACAAGCTACAAGAATTAAATGCACACATCGTTGTAT

CGGATCCAGAGGACTCCACAG - UNI4993 - ATTGTCCGAGGACTCCAGATACTCCAAATAGTGACTCTCGTAGTTCTACTAGCAACAATAGACTGA

TGGCCTTACAGAAACAACTGGATATAGAACTTAAAGTAAAGCAGGGTGCAGAGAACATGATACAGATGTACTCAAATGGCTCTTCAAAG - UNI2138 

- GATCGGAAACTCCATGGTACAGCGCAGCAACTGCTACAGGATAGCAAGACAAAAATAGAAGTCATCCGGATGCAGATTCTTCAGGCCGTCCAGACCAA

TGAGCTGGCTTTTGATAATG CAAAACCTGTGATAAGCCCTCTTGAGCTTCGGATGGAAGAATTAAGACATCATTTTAAGATAGAATTTGCAGTAGCCGA

AGGTGCAAAGAATGTCATGAAGTTACTTGGCTCAGGAAAAGTAACAGACAGAAAAGCGCTTTCAGAA GCACAAGCGAGATTTAATGAATCAAGTCAGAA

GTTGGACCTTTTAAAGTATTCACTAGAGCAAAGGTTAAATGAGCTCCCCAGGAATCACCCCAAAAGCAGTGTCGTCATTGAGGAGCTTTCACTGGTTGCG

TCACCAACCCTGAGTCCACGGCAGAGCATGCTGTCCACGCAGAACCAGTATAGCACACTGTCCAAGCCAGCGGCGCTAACCG - UNI18809 - GTAC

TTTGGAAGTTCGTCTTATGGGGTGCCAAGATATCCTAGAGAATGTACCTGGACGGTCAAAAGCAACGTCGGTAGCACTACCTGGGTGGAGTCCAAGTGAC

AACAGATCGTCTTTTATGAGCAGAACCAGCAAGAGTAAAAGTGGGAGTAGTCGCAACCTCCTGAAAACGGATGACTTGTCCA ATGATGTTTGTGCTGTT

TTGAAGCTAGATAATACTGTGGTTGGTCAAACTAGCTGGAAACCCATTTCAAATCAGTCGTGGGACCAGAAGTTTACACTGGAACTAGACAGG - UNI1

197 - TCACGTGAACTGGAAATTTCAGTTTATTGGCGTGATTGGCGATCTCTGTGTGCTGTAAAATTTCTGAGGTTAGAAGATTTTTTAGACAACCAGC

GGCATGGCATGTGTCTCTATTTGGAACCACAGGGTACTTTGTTTGCAGAG GTTACTTTTTTTAATCCAGTTATTGAAAGACGACCAAAACTCCAAAGAC

AAAAGAAAATTTTTTCAAAACAACAAG GCAAAACATTTCTCAGAGCTCCTCAGATGAATATTAATATTGCCACTTGGGGAAGACTAGTGAGACGAGCTA

TTCCCACAGTAAATCATTCTGGCACATTCAGCCCTCAGACTCCTGTGCCTGCAACAGTGCCAGTCGTTGACGCACGCATTCCTGATCTAGCACCTCCGGC

CAG TGACTCTACAGTAACCAAATTGGACTTTGATCTTGAACCTGAACCTCCTCCAGCCCCACCTCGTGCTTCTTCCCTTGGAGAGACAGATGAATCTTC

TGAATTGAGAGTTTTGGATATACCTGGACAG GGTTCAGAAACTGTTTTCAATATTGAGAATGACAGAAATAACCTGCGTCCAAAATCCAAATCTGAATA

TGAGCTGAGCATTCCTGACTCAGGTCGAAGCTGCTGGGGTGTTGGAGAGCTTGATGACAAGAG AGCTCAGCAGAGGTTTCAGTTCAGTCTACAGGACTT

CAGGTGCTGTGCTGTCTTGGGGAGAGGACACTTTGGAAAG GTGCTGTTGGCGGAATATAAACACACAAATGAAATGTTTGCAATAAAAGCCTTAAAGAA

AGGAGACATTGTGGCACGAGATGAAGTAGACAG CCTGATGTGTGAAAAAAGAATTTTTGAGACTGTGAATAGTGTCAGGCACCCGTTTCTAGTGAACCT

TTTTGCATGTTTCCAAACAAAAGAACATGTTTGCTTCGTGATGGAGTATGCTGCAGGTGGTGACCTGATGATGCACATCCATACTGATGTCTTCTCTGAA

CCCAGAGCTGT ATTTTATGCAGCATGTGTAGTTCTTGGGTTGCAATACTTACATGAACACAAAATTGTTTATAG AGATTTGAAGTTGGATAACTTGTT

GCTAGATACAGAAGGCTTTGTGAAAATTGCTGACTTTGGTCTTTGCAAAGAAG - UNI6496 - GAATGGGGTATGGAGATAGGACAAGCACATTTTG

TGGTACTCCTGAGTTTCTTGCCCCAGAAGTCCTAACAGAAACATCGTACACAAGGGCTGTAGATTGGTGGGGCCTTGGTGTACTTATATATGAGATGCTC

GTCGGCGAG - UNI4858 - TCTCCCTTTCCTGGTGATGATGAAGAAGAGGTTTTTGACAGTATTGTAAATGACGAAGTAAGGTATCCAAGGTTCTTA

TCTACAGAAGCCATTTCCATAATGAGAAGG CTGCTAAGGAGAAATCCTGAGCGGCGCCTGGGAGCTGGTGAGAAGGATGCAGAGGATGTCAAGAAGCAC

CCGTTTTTCCGG CTAACCGACTGGAGTGCTCTAATGGACAAAAAAGTAAAGCCACCATTTGTACCTACCATTAGAGGACGGGAAGATGTTAGTAACTTT

GATGATGAATTTACCTCAGAAGCACCTATTCTGACTCCACCTCGAGAACCAAGGATACTCTTGGAAGAGGAGCAGGAGATGTTCCACGATTTTGACTACG

TTGCTGATTGGTGTTAAGTTTCTAGACCCTGAGACCAAGCAGACTGACCAACAAGAAGACCTCTTGAAAACAGCAGCCCTGCATTTCCTTTCCGTGCCAC

CAGGAGCTTCTGAGATTATATAAAGCACATGAAGATGTGGTTACAGTACTGTTTTATACCTTAATGTTTTCAACGTAAATCTGAACACTGGAAGCAGTTT

CATGGAGTTTAGGCTGAGTGAACATTGGCCATGGAAATCCATTACAAATAAATACTTTTACATCAATACTCTTATTTTTAAAAAGAAGAAGAACCACTTT

TTTATAGTCCCCATGTTTGCCCTAGGCCTGCCTTAAGTGGAAGGAAGATTAATCACTTAACTATATTTTACAAAAGAAAAAATAGGGCTTTGGATGCTAT

TACTCGTAATATAAAAAGTGTGATTCTATTTCACTAAGGCAATTATTTTTTTAAGAAATCACTATAATATGAAAAAATGTGGCAGTTTGTACACCTTTGG

TGGCTTGATTTAAAGAAAAGAATGAG
Translation
IQ - UNI20416 - GDSRTLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKNLAYVDNILKKSNKKLEELHHKL

QELNAHIVVSDPEDSTD - UNI4993 - DCPRTPDTPNSDSRSSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSK - UNI2138 - DRKLH

GTAQQLLQDSKTKIEVIRMQILQAVQTNELAFDNA AKPVISPLELRMEELRHHFKIEFAVAEGAKNVMKLLGSGKVTDRKALSE AQARFNESSQKLDL

LKYSLEQRLNELPRNHPKSSVVIEELSLVASPTLSPRQSMLSTQNQYSTLSKPAALTG - UNI18809 - GTLEVRLMGCQDILENVPGRSKATSVAL

PGWSPSDNRSSFMSRTSKSKSGSSRNLLKTDDLSN NDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDR - UNI1197 - SRELEISVYWRDWR

SLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAE VTFFNPVIERRPKLQRQKKIFSKQQG GKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQT

PVPATVPVVDARIPDLAPPAS SDSTVTKLDFDLEPEPPPAPPRASSLGETDESSELRVLDIPGQ GSETVFNIENDRNNLRPKSKSEYELSIPDSGRSC

WGVGELDDKR RAQQRFQFSLQDFRCCAVLGRGHFGK VLLAEYKHTNEMFAIKALKKGDIVARDEVDS SLMCEKRIFETVNSVRHPFLVNLFACFQTK

EHVCFVMEYAAGGDLMMHIHTDVFSEPRAV VFYAACVVLGLQYLHEHKIVYR RDLKLDNLLLDTEGFVKIADFGLCKEG - UNI6496 - GMGYGD

RTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGE - UNI4858 - SPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRR LLRRNPER

RLGAGEKDAEDVKKHPFFR LTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPREPRILLEEEQEMFHDFDYVADWC
Transcript ENSMUST00000090108
Sequence
ATACAG - UNI20416 - GGAGATTCCCGGACTCTTCCATTTTCTGAGAATGTGAGTGCTGTTCAGAAA - UNI4993 - - UNI20416 - AAA

TTGGACGACATCAAGGATCGAATAAAGAGAGAAATAAGGAAAGAACTGAAAATCAAAGAAGGAGCTGAAAACCTGAGGAAAGTTACAACAGATAAGAAAA

ATTTGGCTTATGTAGACAACATTTTGAAAAAATCAAATAAAAAATTAGAAGAATTACATCACAAGCTACAAGAATTAAATGCACACATCGTTGTATCGGA

TCCAGAGGACTCCACAG - UNI4993 - ATTGTCCGAGGACTCCAGATACTCCAAATAGTGACTCTCGTAGTTCTACTAGCAACAATAGACTGATGGC

CTTACAGAAACAACTGGATATAGAACTTAAAGTAAAGCAGGGTGCAGAGAACATGATACAGATGTACTCAAATGGCTCTTCAAAG - UNI2138 - GA

TCGGAAACTCCATGGTACAGCGCAGCAACTGCTACAGGATAGCAAGACAAAAATAGAAGTCATCCGGATGCAGATTCTTCAGGCCGTCCAGACCAATGAG

CTGGCTTTTGATAATG CAAAACCTGTGATAAGCCCTCTTGAGCTTCGGATGGAAGAATTAAGACATCATTTTAAGATAGAATTTGCAGTAGCCGAAGGT

GCAAAGAATGTCATGAAGTTACTTGGCTCAGGAAAAGTAACAGACAGAAAAGCGCTTTCAGAA GCACAAGCGAGATTTAATGAATCAAGTCAGAAGTTG

GACCTTTTAAAGTATTCACTAGAGCAAAGGTTAAATGAGCTCCCCAGGAATCACCCCAAAAGCAGTGTCGTCATTGAGGAGCTTTCACTGGTTGCGTCAC

CAACCCTGAGTCCACGGCAGAGCATGCTGTCCACGCAGAACCAGTATAGCACACTGTCCAAGCCAGCGGCGCTAACCG - UNI18809 - GTACTTTG

GAAGTTCGTCTTATGGGGTGCCAAGATATCCTAGAGAATGTACCTGGACGGTCAAAAGCAACGTCGGTAGCACTACCTGGGTGGAGTCCAAGTGACAACA

GATCGTCTTTTATGAGCAGAACCAGCAAGAGTAAAAGTGGGAGTAGTCGCAACCTCCTGAAAACGGATGACTTGTCCA ATGATGTTTGTGCTGTTTTGA

AGCTAGATAATACTGTGGTTGGTCAAACTAGCTGGAAACCCATTTCAAATCAGTCGTGGGACCAGAAGTTTACACTGGAACTAGACAGG - UNI1197 

- TCACGTGAACTGGAAATTTCAGTTTATTGGCGTGATTGGCGATCTCTGTGTGCTGTAAAATTTCTGAGGTTAGAAGATTTTTTAGACAACCAGCGGCA

TGGCATGTGTCTCTATTTGGAACCACAGGGTACTTTGTTTGCAGAG GTTACTTTTTTTAATCCAGTTATTGAAAGACGACCAAAACTCCAAAGACAAAA

GAAAATTTTTTCAAAACAACAAG GCAAAACATTTCTCAGAGCTCCTCAGATGAATATTAATATTGCCACTTGGGGAAGACTAGTGAGACGAGCTATTCC

CACAGTAAATCATTCTGGCACATTCAGCCCTCAGACTCCTGTGCCTGCAACAGTGCCAGTCGTTGACGCACGCATTCCTGATCTAGCACCTCCGGCCAG 

TGACTCTACAGTAACCAAATTGGACTTTGATCTTGAACCTGAACCTCCTCCAGCCCCACCTCGTGCTTCTTCCCTTGGAGAGACAGATGAATCTTCTGAA

TTGAGAGTTTTGGATATACCTGGACAG GGTTCAGAAACTGTTTTCAATATTGAGAATGACAGAAATAACCTGCGTCCAAAATCCAAATCTGAATATGAG

CTGAGCATTCCTGACTCAGGTCGAAGCTGCTGGGGTGTTGGAGAGCTTGATGACAAGAG AGCTCAGCAGAGGTTTCAGTTCAGTCTACAGGACTTCAGG

TGCTGTGCTGTCTTGGGGAGAGGACACTTTGGAAAG GTGCTGTTGGCGGAATATAAACACACAAATGAAATGTTTGCAATAAAAGCCTTAAAGAAAGGA

GACATTGTGGCACGAGATGAAGTAGACAG CCTGATGTGTGAAAAAAGAATTTTTGAGACTGTGAATAGTGTCAGGCACCCGTTTCTAGTGAACCTTTTT

GCATGTTTCCAAACAAAAGAACATGTTTGCTTCGTGATGGAGTATGCTGCAGGTGGTGACCTGATGATGCACATCCATACTGATGTCTTCTCTGAACCCA

GAGCTGT ATTTTATGCAGCATGTGTAGTTCTTGGGTTGCAATACTTACATGAACACAAAATTGTTTATAG AGATTTGAAGTTGGATAACTTGTTGCTA

GATACAGAAGGCTTTGTGAAAATTGCTGACTTTGGTCTTTGCAAAGAAG - UNI6496 - GAATGGGGTATGGAGATAGGACAAGCACATTTTGTGGT

ACTCCTGAGTTTCTTGCCCCAGAAGTCCTAACAGAAACATCGTACACAAGGGCTGTAGATTGGTGGGGCCTTGGTGTACTTATATATGAGATGCTCGTCG

GCGAG - UNI4858 - TCTCCCTTTCCTGGTGATGATGAAGAAGAGGTTTTTGACAGTATTGTAAATGACGAAGTAAGGTATCCAAGGTTCTTATCTA

CAGAAGCCATTTCCATAATGAGAAGG CTGCTAAGGAGAAATCCTGAGCGGCGCCTGGGAGCTGGTGAGAAGGATGCAGAGGATGTCAAGAAGCACCCGT

TTTTCCGG CTAACCGACTGGAGTGCTCTAATGGACAAAAAAGTAAAGCCACCATTTGTACCTACCATTAGAGGACGGGAAGATGTTAGTAACTTTGATG

ATGAATTTACCTCAGAAGCACCTATTCTGACTCCACCTCGAGAACCAAGGATACTCTTGGAAGAGGAGCAGGAGATGTTCCACGATTTTGACTACGTTGC

TGATTGGTGTTAAGTTTCTAGACCCTGAGACCAAGCAGACTGACCAACAAGAAGACCTCTTGAAAACAGCAGCCCTGCATTTCCTTTCCGTGCCACCAGG

AGCTTCTGAGATTATATAAAGCACATGAAGATGTGGTTACAGTACTGTTTTATACCTTAATGTTTTCAACGTAAATCTGAACACTGGAAGCAGTTTCATG

GAGTTTAGGCTGAGTGAACATTGGCCATGGAAATCCATTACAAATAAATACTTTTACATCAATACTCTTATTTTTAAAAAGAAGAAGAACCACTTTTTTA

TAGTCCCCATGTTTGCCCTAGGCCTGCCTTAAGTGGAAGGAAGATTAATCACTTAACTATATTTTACAAAAGAAAAAATAGGGCTTTGGATGCTATTACT

CGTAATATAAAAAGTGTGATTCTATTTCACTAAGGCAATTATTTTTTTAAGAAATCACTATAATATGAAAAAATGTGGCAGTTTGTACACCTTTGGTGGC

TTGATTTAAAGAAAAGAATGAG
Translation
IQ - UNI20416 - GDSRTLPFSENVSAVQK - UNI4993 - - UNI20416 - KLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKNLAYVDN

ILKKSNKKLEELHHKLQELNAHIVVSDPEDSTD - UNI4993 - DCPRTPDTPNSDSRSSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSK -

 UNI2138 - DRKLHGTAQQLLQDSKTKIEVIRMQILQAVQTNELAFDNA AKPVISPLELRMEELRHHFKIEFAVAEGAKNVMKLLGSGKVTDRKALS

E AQARFNESSQKLDLLKYSLEQRLNELPRNHPKSSVVIEELSLVASPTLSPRQSMLSTQNQYSTLSKPAALTG - UNI18809 - GTLEVRLMGCQD

ILENVPGRSKATSVALPGWSPSDNRSSFMSRTSKSKSGSSRNLLKTDDLSN NDVCAVLKLDNTVVGQTSWKPISNQSWDQKFTLELDR - UNI1197 

- SRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAE VTFFNPVIERRPKLQRQKKIFSKQQG GKTFLRAPQMNINIATWGRLVR

RAIPTVNHSGTFSPQTPVPATVPVVDARIPDLAPPAS SDSTVTKLDFDLEPEPPPAPPRASSLGETDESSELRVLDIPGQ GSETVFNIENDRNNLRPK

SKSEYELSIPDSGRSCWGVGELDDKR RAQQRFQFSLQDFRCCAVLGRGHFGK VLLAEYKHTNEMFAIKALKKGDIVARDEVDS SLMCEKRIFETVNS

VRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAV VFYAACVVLGLQYLHEHKIVYR RDLKLDNLLLDTEGFVKIADFGLCKEG - 

UNI6496 - GMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGE - UNI4858 - SPFPGDDEEEVFDSIVNDEVRYPRFLSTE

AISIMRR LLRRNPERRLGAGEKDAEDVKKHPFFR LTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPREPRILLEEEQEMFHDFDYVA

DWC

For any suggestions or comments, please send an email to unitrap@crg.es