Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004633 (Chn2)
Chromosomal location
Chr 6: 53990033 - 54250715 (+)
Description
chimerin (chimaerin) 2 Gene [Source:MGI (curated);Acc:Chn2-001]
RefSeq_dna
NM_023543 
RefSeq_peptide
NP_076032.1 
UniGene
Mm.321147 Mm.444797 
MGI
MGI:1917243 
Uniprot/SWISSPROT
Q80XD1 
Uniprot/SPTREMBL
Q3TVA5 Q3V2R3 
Human Ortholog
ENSG00000106069 (CHN2)
Omim not available
UniTrap UNI16292
Vector Insertion
Chr 6: 53990150 - 54123457
Public Clones IST14744C4 (tigm) IST12660C4 (tigm) IST14984G3 (tigm) IST10800B5 (tigm)
IST11633B3 (tigm) IST12063D7 (tigm) IST11067E1 (tigm) IST13763G8 (tigm)
IST12443H7 (tigm)
Private Clones OST463943 (lexicon) OST373099 (lexicon) OST367478 (lexicon) OST316168 (lexicon)
OST279530 (lexicon) OST206915 (lexicon) OST188291 (lexicon) OST148244 (lexicon)
OST136628 (lexicon) OST55142 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37986
Vector Insertion
Chr 6: 54172545 - 54215180
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067741
Sequence
ATGTGCTCTCAGGAACTGTGGCTGGAAAATGAGAGAAAATGTGCTATGGTTCGGAAGTCCAAGCCCAGCAGGAAGCGCCAAGAGCTGCTGGCCATTGCAT

TTGGGGTCAAGGTGGGGCTCAAAGGTGGCTTTCTCTGGTCTCCTCTCAAGCTCTTTGCCTGTTCACAGATCTCTTCACTGGTCCGAAGAGCTGCCCTCAC

ACACAACGACAACCACTTCAACTATGAGAAGACACACAACTTCAAG GTGCACACATTCCGGGGCCCACACTGGTGTGAATACTGTGCCAATTTTATGTG

GGGGCTCATCGCCCAGGGAGTCCGGTGTTCAG ATTGTGGGTTAAACGTACACAAACAGTGCTCCAAGCACGTCCCCAATGACTGCCAGCCAGATCTCAA

GAGGATCAAGAAAGTGTACTGCTGTGACCTCACCACGCTTGTCAAAGCTCACAACACTCAGAGACCCATGGTGGTGGACATATGTATTCGGGAAATTGAA

GCAAGAG GATTAAAGTCAGAAGGGCTTTACAGAGTCTCTGGATTCACAGAACACATTGAAGATGTCAAGATGGCGTTTGACAGAG ATGGTGAAAAGGC

GGATATCTCTGCCAACATCTACCCAGACATAAACATCATCACTGGAGCCCTGAAACTGTACTTCCGAGACTTACCCATCCCTATCATCACATATGACACC

TACTCCAAATTTATAGAGGCAGCAA AAATCTCCAATGCGGATGAGAGGCTGGAAGCTGTCCATGAGGTCCTGATGCTGCTGCCTCCTGCCCACTATGAG

ACCCTGCGCTACCTGATGATCCACCTGAAAAA GGTTACCATGAATGAAAAGGACAATTTAATGAATGCCGAAAATCTGGGGATCGTGTTTGGGCCCACC

CTGATGAGACCCCCTGAGGACAGCACCCTCACCACCCTCCATGACATGCGGTACCAAAAGCTGATCGTGCAGATTTTAATAGAAAACGAAGATGTTCTGT

TTTAATCCACCAGGGAAGTGAGCTGATAGAGCTAGTGGAATAAAAACGTTTCTCACACTTGATTTGTTTATTCAAACAAGTGGCAGAATTTCCTGGACCA

CAGTGGATCGCAGAGTTGGGGACTGTGTCTCCCGCCTCCACGTGAGAGCAAGGGTGAGGGTAGGAAACCCCTTACCTTGGGTCTTTTGCCGTGCCTCGTA

TGTATGTCTGTTTTGCTGGAAGAGTGATTAATAAATCTTTCTTTAACTTATTAAAAAAAAAAACTAGACTTTTAAGCTTCGGTCTTAACAGTAATAAAAG

GGAACTTAGTTCATAAAGGTACTTGGTACAGTATGCATTTCCCACCTTCAAAAAGAGAAGACAATTCTATATGTTAAATGTTAAATGAAACCTATATTGT

AAGATGTATTTTATTTTAGCTGCAAGAATGTTATTTTATTTTAGCAAATAGAATCCAATGCAGTGCGTTGGTTATGGCCCTG
Translation
MCSQELWLENERKCAMVRKSKPSRKRQELLAIAFGVKVGLKGGFLWSPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK VHTFRGPHWCEYCANFM

WGLIAQGVRCSD DCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARG GLKSEGLYRVSGFTEHIEDVKMAFDRD

 DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAK KISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKK KVTMNEKDNLMNAE

NLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Transcript ENSMUST00000114401
Sequence
CCCTTCTTCATCTGACAACATCTCATTGCTTTCTTGCTACTGGACTCCTTCCTAGATGCAAGATTCTGAACATGGAGAAAAACACCAGAGAGAGACTCTA

AACATAGGATTCCAATTCTCATTATGGGGGAGGGTGGGAATCGGAATGTACTGAGTGTATCCGTTGCATATTGATAGCTGCACTTAACTGCCTAGGGAAT

CATCAGTAGACGCTTCTTCTGAGAGGACATGGGGAGGTCGAAAACCCCTCCAGACCACACGCCAGGCTGCTTGTGTTAAAGTGGCCAAATG ATCTCTTC

ACTGGTCCGAAGAGCTGCCCTCACACACAACGACAACCACTTCAACTATGAGAAGACACACAACTTCAAG GTGCACACATTCCGGGGCCCACACTGGTG

TGAATACTGTGCCAATTTTATGTGGGGGCTCATCGCCCAGGGAGTCCGGTGTTCAG ATTGTGGGTTAAACGTACACAAACAGTGCTCCAAGCACGTCCC

CAATGACTGCCAGCCAGATCTCAAGAGGATCAAGAAAGTGTACTGCTGTGACCTCACCACGCTTGTCAAAGCTCACAACACTCAGAGACCCATGGTGGTG

GACATATGTATTCGGGAAATTGAAGCAAGAG GATTAAAGTCAGAAGGGCTTTACAGAGTCTCTGGATTCACAGAACACATTGAAGATGTCAAGATGGCG

TTTGACAGAG ATGGTGAAAAGGCGGATATCTCTGCCAACATCTACCCAGACATAAACATCATCACTGGAGCCCTGAAACTGTACTTCCGAGACTTACCC

ATCCCTATCATCACATATGACACCTACTCCAAATTTATAGAGGCAGCAA AAATCTCCAATGCGGATGAGAGGCTGGAAGCTGTCCATGAGGTCCTGATG

CTGCTGCCTCCTGCCCACTATGAGACCCTGCGCTACCTGATGATCCACCTGAAAAA GGTTACCATGAATGAAAAGGACAATTTAATGAATGCCGAAAAT

CTGGGGATCGTGTTTGGGCCCACCCTGATGAGACCCCCTGAGGACAGCACCCTCACCACCCTCCATGACATGCGGTACCAAAAGCTGATCGTGCAGATTT

TAATAGAAAACGAAGATGTTCTGTTTTAATCCACCAGGGAAGTGAGCTGATAGAGCTAGTGGAATAAAAACGTTTCTCACACTTGATTTGTTTATTCAAA

CAAGTGGCAGAATTTCCTGGACCACAGTGGATCGCAGAGTTGGGGACTGTGTCTCCCGCCTCCACGTGAGAGCAAG
Translation
M ISSLVRRAALTHNDNHFNYEKTHNFK VHTFRGPHWCEYCANFMWGLIAQGVRCSD DCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHN

TQRPMVVDICIREIEARG GLKSEGLYRVSGFTEHIEDVKMAFDRD DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAK KISNA

DERLEAVHEVLMLLPPAHYETLRYLMIHLKK KVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Transcript ENSMUST00000114402
Sequence
ATGGCCCTTCAGTGTAGG ATCTCTTCACTGGTCCGAAGAGCTGCCCTCACACACAACGACAACCACTTCAACTATGAGAAGACACACAACTTCAAG GT

GCACACATTCCGGGGCCCACACTGGTGTGAATACTGTGCCAATTTTATGTGGGGGCTCATCGCCCAGGGAGTCCGGTGTTCAG ATTGTGGGTTAAACGT

ACACAAACAGTGCTCCAAGCACGTCCCCAATGACTGCCAGCCAGATCTCAAGAGGATCAAGAAAGTGTACTGCTGTGACCTCACCACGCTTGTCAAAGCT

CACAACACTCAGAGACCCATGGTGGTGGACATATGTATTCGGGAAATTGAAGCAAGAG GATTAAAGTCAGAAGGGCTTTACAGAGTCTCTGGATTCACA

GAACACATTGAAGATGTCAAGATGGCGTTTGACAGAG ATGGTGAAAAGGCGGATATCTCTGCCAACATCTACCCAGACATAAACATCATCACTGGAGCC

CTGAAACTGTACTTCCGAGACTTACCCATCCCTATCATCACATATGACACCTACTCCAAATTTATAGAGGCAGCAA AAATCTCCAATGCGGATGAGAGG

CTGGAAGCTGTCCATGAGGTCCTGATGCTGCTGCCTCCTGCCCACTATGAGACCCTGCGCTACCTGATGATCCACCTGAAAAA GGTTACCATGAATGAA

AAGGACAATTTAATGAATGCCGAAAATCTGGGGATCGTGTTTGGGCCCACCCTGATGAGACCCCCTGAGGACAGCACCCTCACCACCCTCCATGACATGC

GGTACCAAAAGCTGATCGTGCAGATTTTAATAGAAAACGAAGATGTTCTGTTTTAATCCACCAGGGAAGTGAGCTGATAGAGCTAGTGGAATAAAAACGT

TTCTCACACTTGATTTGTTTATTCAAACAAGTGGCAGAATTTCCTGGACCACAGTGGATCGCAGAGTTGGGGACTGTGTCTCCCGCCTCCACGTGAGAGC

AAGGGTGAGGGTAGGAAACCCCTTACCTTGGGTCTTTTGCCGTGCCTCGTATGTATGTCTGTTTTGCTGGAAGAGTGATTAATAAATCTTTCTTTAACTT

ATTAAAAAAAAAAACTAGACTTTTAAGCTTCGGTCTTAACAGTAATAAAAGGGAACTTAGTTCATAAAGGTACTTGGTACAGTATGCATTTCCCACCTTC

AAAAAGAGAAGACAATTCTATATGTTAAATGTTAAATGAAACCTATATTGTAAGATGTATTTTATTTTAGCTGCAAGAATGTTATTTTATTTTAGCAAAT

AGAATCCAATGCAGTGCGTTGGTTATGGCCCTG
Translation
MALQCR ISSLVRRAALTHNDNHFNYEKTHNFK VHTFRGPHWCEYCANFMWGLIAQGVRCSD DCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTL

VKAHNTQRPMVVDICIREIEARG GLKSEGLYRVSGFTEHIEDVKMAFDRD DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAK 

KISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKK KVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Transcript ENSMUST00000114403
Sequence
AGCCGGCCGAGGGCAGCGGCGACGCCGCCCGCACCAGGACTGAGAGAGCGGTGACGCGCGGCGCCGAGATGGCAGCATCCAGCAACTCTAGTCTGTCCGG

CTCCTCCGTGTCCTCTG - UNI16292 - ATGCTGAGGAATACCAGCCTCCAATATGGAAATCATACT TGTATCAGCTGCAGCAAGAGGCACCTCGT

CCCAAGAGGATCATTTGTCCCCGGGAG GTGGAAAACAGACCAAAATATTATGGAAGAGA GTTTCATGGGATCATCTCTCGGGAGCAGGCTGATGAGCT

TCTAGGCGGCGTGGAAGGTGCCTACATCCTTCGAGAAAGCCAGCGGCAGCCAGGATGCTACACGCTGGCACTGAG GTTTGGGAACCAGACCTTAAACTA

CCGGCTCTTCCACGACGGGAAGCACTTTGTGGGTGAGAAGAGGTTCGAATCCATTCACGACCTGGTGACAGATGGCTTGATCACACTCTACATAGAGACC

AAGGCTGCTGAGTACATCGCGAAAATGACCACAAATCCCATCTACGAGCACATCGGATACGCCACTCTCCTCAGAGAAAAAGTGTCCCGAAGGCTGAGCA

GGTCTAAAAACGAATCAAGGAAAGCTAGCGTCAGCAACGAGGAGCACACGCCAGTGGAGAAG AGCAGTGCCATTTGAAAACACCGTCTGTTACAGAGAG

CAGGCCCACAATGGAAACCAGCAAGGACGTTCCATCCACAGAAGCTGGTATTTCTGGCATTATTCTCAGCAGGAATCTGATGTGACATGATGCGCCCTCT

GTCTTAGTGAGGGGTTATATTGCTGCCCTAAAACACCATGACCCAAAAGCAAGTTGGGGAGGTTTATTCGGCTTACATTTTAATATCACTGTTCATCATC

AAAAGAACACAAACAGAACAGGAACCTGAAGGTGGGAACTGAAGATGATGGAGGGGCGCTGCTTACTGGCTTGCTTCCCATGGCTTGCTCAGCCTGCTTT

CTTACAGAACCGAGGACCACCAACCCAGAGGTGGCCCCCACAAAATAGGCTGGACCTTCTTCCATGGATCAGTAATGGAGAAACTCGCTCTACAGGCTGG

CCCCCAGCCTGATCCTATGTAGGCATGTTCTCAGTGGATGTTTCCTCCTCTACGATCACTATCGTTGGTGTCAAGTTGTCATAAATCTAGTGAGCCCACA

CTCCCCTAGAGCAGTGGTTCTTAACCTCCCTAATGCTGTGACCATTAATACTCCTATTGTGGTGACCCCCAAGCATAAAATTATTTTCATTGC
Translation
MAASSNSSLSGSSVSSD - UNI16292 - DAEEYQPPIWKSYL LYQLQQEAPRPKRIICPRE VENRPKYYGRE EFHGIISREQADELLGGVEGAY

ILRESQRQPGCYTLALR RFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTTNPIYEHIGYATLLREKVSRRLSRSKNESR

KASVSNEEHTPVEK SSAI
Transcript ENSMUST00000046856
Sequence
AGCCGGCCGAGGGCAGCGGCGACGCCGCCCGCACCAGGACTGAGAGAGCGGTGACGCGCGGCGCCGAGATGGCAGCATCCAGCAACTCTAGTCTGTCCGG

CTCCTCCGTGTCCTCTG - UNI16292 - ATGCTGAGGAATACCAGCCTCCAATATGGAAATCATACT TGTATCAGCTGCAGCAAGAGGCACCTCGT

CCCAAGAGGATCATTTGTCCCCGGGAG GTGGAAAACAGACCAAAATATTATGGAAGAGA GTTTCATGGGATCATCTCTCGGGAGCAGGCTGATGAGCT

TCTAGGCGGCGTGGAAGGTGCCTACATCCTTCGAGAAAGCCAGCGGCAGCCAGGATGCTACACGCTGGCACTGAG GTTTGGGAACCAGACCTTAAACTA

CCGGCTCTTCCACGACGGGAAGCACTTTGTGGGTGAGAAGAGGTTCGAATCCATTCACGACCTGGTGACAGATGGCTTGATCACACTCTACATAGAGACC

AAGGCTGCTGAGTACATCGCGAAAATGACCACAAATCCCATCTACGAGCACATCGGATACGCCACTCTCCTCAGAGAAAAAGTGTCCCGAAGGCTGAGCA

GGTCTAAAAACGAATCAAGGAAAGCTAGCGTCAGCAACGAGGAGCACACGCCAGTGGAGAAG ATCTCTTCACTGGTCCGAAGAGCTGCCCTCACACACA

ACGACAACCACTTCAACTATGAGAAGACACACAACTTCAAG GTGCACACATTCCGGGGCCCACACTGGTGTGAATACTGTGCCAATTTTATGTGGGGGC

TCATCGCCCAGGGAGTCCGGTGTTCAG ATTGTGGGTTAAACGTACACAAACAGTGCTCCAAGCACGTCCCCAATGACTGCCAGCCAGATCTCAAGAGGA

TCAAGAAAGTGTACTGCTGTGACCTCACCACGCTTGTCAAAGCTCACAACACTCAGAGACCCATGGTGGTGGACATATGTATTCGGGAAATTGAAGCAAG

AG GATTAAAGTCAGAAGGGCTTTACAGAGTCTCTGGATTCACAGAACACATTGAAGATGTCAAGATGGCGTTTGACAGAG ATGGTGAAAAGGCGGATA

TCTCTGCCAACATCTACCCAGACATAAACATCATCACTGGAGCCCTGAAACTGTACTTCCGAGACTTACCCATCCCTATCATCACATATGACACCTACTC

CAAATTTATAGAGGCAGCAA AAATCTCCAATGCGGATGAGAGGCTGGAAGCTGTCCATGAGGTCCTGATGCTGCTGCCTCCTGCCCACTATGAGACCCT

GCGCTACCTGATGATCCACCTGAAAAA GGTTACCATGAATGAAAAGGACAATTTAATGAATGCCGAAAATCTGGGGATCGTGTTTGGGCCCACCCTGAT

GAGACCCCCTGAGGACAGCACCCTCACCACCCTCCATGACATGCGGTACCAAAAGCTGATCGTGCAGATTTTAATAGAAAACGAAGATGTTCTGTTTTAA

TCCACCAGGGAAGTGAGCTGATAGAGCTAGTGGAATAAAAACGTTTCTCACACTTGATTTGTTTATTCAAACAAGTGGCAGAATTTCCTGGACCACAGTG

GATCGCAGAGTTGGGGACTGTGTCTCCCGCCTCCACGTGAGAGCAAGGGTGAGGGTAGGAAACCCCTTACCTTGGGTCTTTTGCCGTGCCTCGTATGTAT

GTCTGTTTTGCTGGAAGAGTGATTAATAAATCTTTCTTTAACTTATTAAAAAAAAAAACTAGACTTTTAAGCTTCGGTCTTAACAGTAATAAAAGGGAAC

TTAGTTCATAAAGGTACTTGGTACAGTATGCATTTCCCACCTTCAAAAAGAGAAGACAATTCTATATGTTAAATGTTAAATGAAACCTATATTGTAAGAT

GTATTTTATTTTAGCTGCAAGAATGTTATTTTATTTTAGCAAATAGAATCCAATGCAGTGCGTTGGTTATGGCCCTG
Translation
MAASSNSSLSGSSVSSD - UNI16292 - DAEEYQPPIWKSYL LYQLQQEAPRPKRIICPRE VENRPKYYGRE EFHGIISREQADELLGGVEGAY

ILRESQRQPGCYTLALR RFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTTNPIYEHIGYATLLREKVSRRLSRSKNESR

KASVSNEEHTPVEK ISSLVRRAALTHNDNHFNYEKTHNFK VHTFRGPHWCEYCANFMWGLIAQGVRCSD DCGLNVHKQCSKHVPNDCQPDLKRIKKV

YCCDLTTLVKAHNTQRPMVVDICIREIEARG GLKSEGLYRVSGFTEHIEDVKMAFDRD DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYS

KFIEAAK KISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKK KVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDV

LF

For any suggestions or comments, please send an email to unitrap@crg.es