Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004891 (Nes)
Chromosomal location
Chr 3: 87775015 - 87784373 (+)
Description
nestin Gene [Source:MGI (curated);Acc:Nes]
RefSeq_dna
NM_016701 
RefSeq_peptide
NP_057910.3 
UniGene
Mm.331129 
MGI
MGI:101784 
Uniprot/SWISSPROT
Q6P5H2 
Uniprot/SPTREMBL
Q8R228 
Human Ortholog
ENSG00000132688 (NES)
Omim not available
UniTrap UNI30192
Vector Insertion
Chr 3: 87779342 - 87780503
Public Clones D085A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118743
Sequence
CTTAAAAGCTCCAAGGGCCACTCCCTTCTCTAGTGCTCCACGTCCGCTTGCCCTCGGGGGGCCAGACCAGCGACATGGAGGGTTGCGTCGGGGAAGAATC

TTTTCAGATGTGGGAGCTCAATCGACGCCTGGAGGCCTACCTGACCCGGGTCAAGACGCTGGAGGAGCAGAACCAGCTGCTCAGTGCCGAGCTTGGGGGA

CTCCGGGCGCAGTCCGGGGACGCCTCCTGGCGAGCCCGAGCCGACGACGAGCTGGCAGCCCTGCGGGTCCTCGTCGATCAGCGCTGGCGGGAGAAGCACG

AGGCTGAGGTGCAGCGCGACAACCTTGCCGAAGAGCTGGAGAGCGTGGCGGGCCGGTGCCAGCAGGTGCGGCTCGCCCGGGAGCGGACCATCGAGGAGGC

GGCCTGCAGCCGGCGCGCGCTCGAGGCGGAGAAGAATGCGCGGGGCTGGCTGAGCACCCAGGCTGCCGAGCTGGAGCGCGAGTTAGAGGCTCTGCGAGCG

TCGCACGAGGAGGAGCGCGCGCACCTGAACGCCCAGGCCGCCTGTACGCCGCGCCGACCCCCCGCGCCGGCCCACGCATCCCCCATCCGGGCCCCTGAAG

TCGAGGAGCTGGCCAGGCGCCTAGGCGAAGTGTGGCGCGGGGCGGTGCGTGACTACCAGGAGCGCGTGGCTCACATGGAGAGCTCGCTGGGCCAGGCCCG

CGAGCGTCTGGGCCAAGCCGTGCGGGGCGCTCGGGAGAGTCGCTTAGAGGTGCAGCAGCTGCAGGCTGATCGCGACAGCCTCCAGGAGCGCAGAGAGGCG

CTGGAACAGAGATTGGAAGGCCGCTGGCAGGACCGGCTGCAGGCCACTGAAAAGTTCCAG CTGGCTGTGGAAGCCCTGGAGCAGGAGAAGCAGGGTCTA

CAGAGTCAGATCGCTCAGATCCTGGAAGGTGGGCAGCAACTGGCACACCTCAAGATGTCCCTTAGTCTGGAAGTGGCTACATACAG GACTCTGCTGGAG

GCTGAGAACTCTCGCTTGCAGACACCTGGAAGAAGTTCCCAGGCTTCTCTTGGCTTTCCTG - UNI30192 - ACCCCAAGCTGAAGCTGCATTTCCT

TGGGATACCAGAGGACCAGCACCTGGGATCTGTGCTCCCTGTCCTCAGCCCAACATCCTTCTCTTCCCCCTTGCCTAATACCCTTGAGACTCCTGTGACA

GCCTTTCTGAAGACACAGGAATTCCTTAAGGCCAGAACCCCCACCTTGGCCAGCACTCCCATCCCACCTATGTCTGAGGCTCCCTATCCTAAAAATGCAG

AGGTCAGAGCCCAGGATGTCCCCCATTCCCTGCTCCAGGGTGGGAGGCAACAGGCTCCAGAGCCTCTTTGGGCTGAGGCCACAGTGCCCAGTTCTACTGG

TGTCCTCCCAGAGCTGGAGGAGCCTGGGGGCGAGCAGCCGGACCACTTCCCTGATGATCCAACCTCCTTAGCCCCACCCCTCAACCCTCACCACTCTATT

TTAGAGGCTAAAGATAGAGAATCCAGTGAGTCTAGAGTTTCTAGCATATTCCAGGAAGAAGAAGGGCAAATCTGGGAACTTGTAAAGAAAGAAGCAGCCA

CAGAGGTAAAAGTAGAAAACAGCTTAGCACAGGAAATACAAGAAAGTGGTCTGGACACAGAAGAAATCCAGGATTCCCAGGGACCTTTGCAGATGGAAAC

CCTGGAGGCTCTAGGAGATGAGCCACTGATGTCTCTGAAAACCCAGAACCATGAGACCCCAGGAAAGGAGAATTGCAATTCATCTATAGAAGAGAACTCG

GGGACAGTAAAAAGCCCAGAAAAAGAAAAACAAACACCACTGAAGTCTTTAGAAGAAAAGAATGTAGAGGCAGAGAAAACTCTAGAAAATGGGGTTCTTG

AACTATCTAAACCTTTAGGAGAAGAAGAACCAAGAATGGAGGATCAAGAATTAATGTCTCCTGAACACACACTAGAGACAGTTTCATTTCTAGGAAAGGA

AAATCAGGAAGTAGTGAGGTCTTCAGAAGAACAGAACTTAGAATCATTGATAACTTTTAAAGAGGAGAGCCAATACCCACTGGGAGGTCCAGAAGCCGAG

GACCAGATGCTTGAAAGACTGGTAGAGAAAGAGGATCAGAGGTTCCCAAGGTCTCCAGAAGAAGACCAGCAGGCGTTTAGACCTCTGGAGAAAGAGAATC

AGGAGCCACTAAGATTTGAAGAAGCAGAGGACCAG - UNI30192 - GTGCTTGAGAGACTGATAGAAAAGGAAAGACAGGAGTCCCTGAAGTCTCCA

GAAGAAGAGGACCAGCAGGCATTTAGACTTCTGGAGAAAGAGAATCAAGAACCACTAAGGTTTGAAGAAGCAGAGGACCAGGTGCTTGAGAGACTGGTAG

AAAAGGAAAGTCAGGAGTCCCTGAAGTCTCCAGAAGAGGAGGACCAGAGGACTGGGAAGCCTCTAGAAAAAGAAAATCAGGAATCTCTGAGGTCTCTTGA

TGAAAACCAGGAGACAATTGTACTGCTAGAAAGCAAGAACCAGAGGCCACTGAGATCTCTAGAAGTAGAAGAGGAGGAGCAGAGAATTGTGAAACCTCTA

GAAAAAGTGAGCCAGGTCTCCCTCGAATCTCTCGAAAAAGAGAATGTGCAGTCACCAAGGTATCTGGAAGAAGATGACCACATGATTAAGAGCCTGCTAG

AAGACAAGACTCATGAGATCCTGGGATCTCTTGAAGATAGAAATGGGGAGAACTTTATACCACCTGAAAATGAGACCCAGGGTTCATTGAGGCCTCCAGA

AGAAGAGGACCAGAGGATTGTGAACCATCTAGAAAAAGAAAGCCAGGAGTTCCTGAGGTCTCCAGAAGCAGAGGAAGAAGAAGAGCAGGTGATGGTGAGA

TCTCTAGAAGGAGAGAACCACGACCCACTGAGCTCTGTGGTGAAAGAGGAGCAGATGGCTGAGAGCAAGCTAGAGAACGAGAGTCAGGACTCCAGGAAGT

CTCTTGAAGATGAGAGCCAGGAGACCTTTGGGTCTCTGGAAAAAGAGAATCTAGAGTCCCTGAGGTCTCTAGCAGGACAGGACCAAGAGGAACAGAAACT

CGAACAAGAGACCCAGCAGCCACTGAGGGCTGTAGAAGATGAGCAGATGACAGTGAACCCTCCAGAAAAGGTGGATCCAGAGTTACCAAAGCCTCTTAGA

AATGACCAGGAAGTAGTCAGATCTCTTGACAAGGAGAATCAAGAGTCACTAGTGTCACTGAATGAAGGAGGTATGGAGACAGTGAAGTCTTCAGAAACAG

AGAACATAGAATCACTGGAGACTGTGGGAGAGTGCCTGGGAAGAAGGAAGTCTGTAGATACTCAAGAGCCATTGTGGTCTACGGAAGTGACTAGTGAGAC

AATAGAACCTCTAGAAGATGAGACCCAAGAACCACTGGGGTGTGTGGATGAGAACCAAGAGGTGCTGACACCCCTTGAAAGGGAGAGTCAAGAACTGAGA

TCTCTGGGCAAGTGGAACCCAGAGACTGTGGAATCACCAGGAGGGGTGGAGGACAGTCAGCAGTGCCTGGAAGTGGAAGAGGGCCCGGAGAGGGAGCAGC

ACCAAGAGTCTCTGAGGTCTCTGGGAGAGGTGGAATGGGAGCTGCCTGGATCTGGAAGTCAACAGAGGTGGGAGGATGTGGTGGAGGATGGAGAAGGTCA

GGAAGCATCCCTGGGGGCTACAGGAGTGGAAACTGAGGATAAGGCAGAGTTGCATCTGAGGGGCCAAGGTGGGGAGGAGAAAGCTGTAGAGGAGGGAGAG

CTGCTGCAGGATGCTGTGGGGGAGGCCTGGAGTCTGGGGAGCTCGGAGCCCAAGGAGCAGAGGGTCCCTGCTGAGCCCCTCGATGACCTGGAGGGACAAC

CAGAGCAGACGGGAACCCTAGAGGTCCCAGTTGCTCAGGGAATGCCAGAGGCAACAGAGCAAGATGAGGACAGAGCCCAAGCAGGTGAACAAGACTCCGT

AGAGGTGACCCTTGGGTTAGAGGCTGCCAGAGCTGGACTGGAACTCGAGCAGGAAGTGGTAGGGCTAGAGGACCCAAGGCATTTCGCCAGGGAGGAGGCC

ATTCACCCATCCCTGGGGGAGGAAAGTGTGAAGGCAAAGATAGATCAGGGCTTGGAAGAGCCTGGAAAGGAACCAAAAGAGGCAGGTGCTCTGGACTCAG

GCATCCCTGAATTACCCAAGACTAGCAGTGAGACTCTGGAATGCAAGGGCTGGGAAGAGTCTGGGGAGGGCTGGGGAGAAGAGGAGGCCTCGCTGGAGAC

CTCAGACCATGAGGGCAGCCATGCCCCTCAGCCCAGGCCCCCTAAGACAGAGGAAGATGAGGGTCTACAGGCAGCGCTAACAGTCCCTGGTCCCAAGCTC

CTGGAACCCTGTTCACCCATCCCGATCTTGACAGATGCCCATGAGCTGCAGCCCCAAGCTGAGGGGATCCAGGAGGCTGGGTGGCAGCCGGAAGCTGGGA

CTGAAGCACTGGGAAGAGTAGAAGATGAGCCAGAGTTTGGTCGTGGGGAGATTCCTGAGGGCCTCCAGGATTGGGAGGAGGGCAGAGAAGACAGTGAGGC

AGATGAGTTAGGGGAAACTCTCCCTGACTCTACTCCCTTGGGCCTCTACCTGAAGTCTCCTGCCTCCCCAAAGTGGGAGCAAGCTGGAGAACAGAGGCTT

TTCCCTCAAGGGGAGGCCAGGAAGGAAGGCTGGAGTCCTGCTGCCCTGGCTGCCCAGGGTCTCAGTGACCCACCAGAGGAAGAGCAGCAAGGCCATGACT

CTGACCTCTCATCTGAGGAATTTGAGGACCTAGGGACTGAGGCCTCTCTTCTTCCAGGGGTTCCCAAAGAGGTGTCCGATCATCTGGGCCAAGAGCCCCC

CGTACTGCAGCCTGCATGCTGGGATCAGGGTGGGGAGTCTGATGGGTTTGCTGATGAGGAAGAGAGTGGGGAAGAGGGAGAGGAAGAAGATGCTGATGAA

GAAGAAGGAGCAGAGTCAGGGACTCAGTGGTGGGGGCCAGGGCCCTCTGGTGGAGGTGTCAAGGTCCAGGATGTCACCCAGAGAGGGGACCTGGAACATG

AATCTGTGGGTGACAGTGGCCTCTGGGATGATGGCTTGAGTGGGGCTGCAGCTAATGTTCTTGTAACTGCCCTAGAGACGGTGTCTCAGGACAGTGCTGA

GCCTTCCGGGTCAGAGGGGTCTGAGTCTGCTTCCTTGGAGGGGGAGGAAGGTCAAGCGATTGACCATTTAGATGCCCCCCAAGAGGTGACTAGCGTGGTC

CCAGGGGCAGGAGACACCTTTGATATCAGTGGCCAGGGCCCCAACCTGGAGTCAGAGCAAGTGAATGGGAGGATGGAGAATGGACTAGAGCAGGCTGAGG

GTCAGGTGGTTCTGCATGGGGACGAGGATCAAGGCATCCCTTTACAGGAACAGGGTACCCTCAAGGCCCCTTTAGTAGGGTCTCCTGTGCATCTAGGCCC

AAGCCAGCCGCTGAAGTTCACTCTGAGTGGGGTAGATGGAGACTCCTGGTCCTCAGGGGAAGATTAGAAACTGCCCCTCTGGCACTGAGGACTTAGTGGG

GGGTGGGGGGAATGTCCCTCCCTGCTCTGGGCCAGCACTCTTAGCTTTGATAACTTGACCTGTGGTATCTCTCGTGGAGAGGTGTGGCTGGCTGAGACAG

GTGAGATCCTGCCTGGATCACCCTGAAGGCTCAGGTCAGCTGAGCCTATAGTTCAACGCCCCCTTTCTTCTGTGGCTCACCTGCTGGAAGAGGCTTGGGC

CCAGAGCTTTCCCACGAGACTGCTCTGGCCAGAGCTTGCTAGCCCTGCCTGTCTACAGTAGCACCACCTGCACAGGGTCTGGTGCATGCCCAGAGGAGCA

GCAATGATGAGTGACTCTCATCATCTCAGCCTGCTGAGATCTTGTTTCTCTCTTCCTCCCTTGAATAAAGCTGTATCCCTACCTACAA
Translation
MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRAQSGDASWRARADDELAALRVLVDQRWREKHEAEVQRDNLAEELESVAGRCQQVRL

ARERTIEEAACSRRALEAEKNARGWLSTQAAELERELEALRASHEEERAHLNAQAACTPRRPPAPAHASPIRAPEVEELARRLGEVWRGAVRDYQERVAH

MESSLGQARERLGQAVRGARESRLEVQQLQADRDSLQERREALEQRLEGRWQDRLQATEKFQ LAVEALEQEKQGLQSQIAQILEGGQQLAHLKMSLSLE

VATYR RTLLEAENSRLQTPGRSSQASLGFPD - UNI30192 - DPKLKLHFLGIPEDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQEFLKAR

TPTLASTPIPPMSEAPYPKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSSTGVLPELEEPGGEQPDHFPDDPTSLAPPLNPHHSILEAKDRESSESR

VSSIFQEEEGQIWELVKKEAATEVKVENSLAQEIQESGLDTEEIQDSQGPLQMETLEALGDEPLMSLKTQNHETPGKENCNSSIEENSGTVKSPEKEKQT

PLKSLEEKNVEAEKTLENGVLELSKPLGEEEPRMEDQELMSPEHTLETVSFLGKENQEVVRSSEEQNLESLITFKEESQYPLGGPEAEDQMLERLVEKED

QRFPRSPEEDQQAFRPLEKENQEPLRFEEAEDQ - UNI30192 - VLERLIEKERQESLKSPEEEDQQAFRLLEKENQEPLRFEEAEDQVLERLVEKE

SQESLKSPEEEDQRTGKPLEKENQESLRSLDENQETIVLLESKNQRPLRSLEVEEEEQRIVKPLEKVSQVSLESLEKENVQSPRYLEEDDHMIKSLLEDK

THEILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEAEEEEEQVMVRSLEGENHDPLSSVVKEEQMAESKLENESQDSRKSLE

DESQETFGSLEKENLESLRSLAGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVVRSLDKENQESLVSLNEGGMETVKSSETENI

ESLETVGECLGRRKSVDTQEPLWSTEVTSETIEPLEDETQEPLGCVDENQEVLTPLERESQELRSLGKWNPETVESPGGVEDSQQCLEVEEGPEREQHQE

SLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELHLRGQGGEEKAVEEGELLQDAVGEAWSLGSSEPKEQRVPAEPLDDLEGQPEQ

TGTLEVPVAQGMPEATEQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHPSLGEESVKAKIDQGLEEPGKEPKEAGALDSGIP

ELPKTSSETLECKGWEESGEGWGEEEASLETSDHEGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSPIPILTDAHELQPQAEGIQEAGWQPEAGTEA

LGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPLGLYLKSPASPKWEQAGEQRLFPQGEARKEGWSPAALAAQGLSDPPEEEQQGHDSDL

SSEEFEDLGTEASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDADEEEGAESGTQWWGPGPSGGGVKVQDVTQRGDLEHESV

GDSGLWDDGLSGAAANVLVTALETVSQDSAEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDTFDISGQGPNLESEQVNGRMENGLEQAEGQV

VLHGDEDQGIPLQEQGTLKAPLVGSPVHLGPSQPLKFTLSGVDGDSWSSGED
Transcript ENSMUST00000090973
Sequence
CGCTGGGTCACTGTCGCCGCTACTCCCTTTCTCCCCCTTAAAAGCTCCAAGGGCCACTCCCTTCTCTAGTGCTCCACGTCCGCTTGCCCTCGGGGGGCCA

GACCAGCGACATGGAGGGTTGCGTCGGGGAAGAATCTTTTCAGATGTGGGAGCTCAATCGACGCCTGGAGGCCTACCTGACCCGGGTCAAGACGCTGGAG

GAGCAGAACCAGCTGCTCAGTGCCGAGCTTGGGGGACTCCGGGCGCAGTCCGGGGACGCCTCCTGGCGAGCCCGAGCCGACGACGAGCTGGCAGCCCTGC

GGGTCCTCGTCGATCAGCGCTGGCGGGAGAAGCACGAGGCTGAGGTGCAGCGCGACAACCTTGCCGAAGAGCTGGAGAGCGTGGCGGGCCGGTGCCAGCA

GGTGCGGCTCGCCCGGGAGCGGACCATCGAGGAGGCGGCCTGCAGCCGGCGCGCGCTCGAGGCGGAGAAGAATGCGCGGGGCTGGCTGAGCACCCAGGCT

GCCGAGCTGGAGCGCGAGTTAGAGGCTCTGCGAGCGTCGCACGAGGAGGAGCGCGCGCACCTGAACGCCCAGGCCGCCTGTACGCCGCGCCGACCCCCCG

CGCCGGCCCACGCATCCCCCATCCGGGCCCCTGAAGTCGAGGAGCTGGCCAGGCGCCTAGGCGAAGTGTGGCGCGGGGCGGTGCGTGACTACCAGGAGCG

CGTGGCTCACATGGAGAGCTCGCTGGGCCAGGCCCGCGAGCGTCTGGGCCAAGCCGTGCGGGGCGCTCGGGAGAGTCGCTTAGAGGTGCAGCAGCTGCAG

GCTGATCGCGACAGCCTCCAGGAGCGCAGAGAGGCGCTGGAACAGAGATTGGAAGGCCGCTGGCAGGACCGGCTGCAGGCCACTGAAAAGTTCCAG CTG

GCTGTGGAAGCCCTGGAGCAGGAGAAGCAGGGTCTACAGAGTCAGATCGCTCAGATCCTGGAAGGTGGGCAGCAACTGGCACACCTCAAGATGTCCCTTA

GTCTGGAAGTGGCTACATACAG GACTCTGCTGGAGGCTGAGAACTCTCGCTTGCAGACACCTGGAAGAAGTTCCCAGGCTTCTCTTGGCTTTCCTG - 

UNI30192 - ACCCCAAGCTGAAGCTGCATTTCCTTGGGATACCAGAGGACCAGCACCTGGGATCTGTGCTCCCTGTCCTCAGCCCAACATCCTTCTCT

TCCCCCTTGCCTAATACCCTTGAGACTCCTGTGACAGCCTTTCTGAAGACACAGGAATTCCTTAAGGCCAGAACCCCCACCTTGGCCAGCACTCCCATCC

CACCTATGTCTGAGGCTCCCTATCCTAAAAATGCAGAGGTCAGAGCCCAGGATGTCCCCCATTCCCTGCTCCAGGGTGGGAGGCAACAGGCTCCAGAGCC

TCTTTGGGCTGAGGCCACAGTGCCCAGTTCTACTGGTGTCCTCCCAGAGCTGGAGGAGCCTGGGGGCGAGCAGCCGGACCACTTCCCTGATGATCCAACC

TCCTTAGCCCCACCCCTCAACCCTCACCACTCTATTTTAGAGGCTAAAGATAGAGAATCCAGTGAGTCTAGAGTTTCTAGCATATTCCAGGAAGAAGAAG

GGCAAATCTGGGAACTTGTAAAGAAAGAAGCAGCCACAGAGGTAAAAGTAGAAAACAGCTTAGCACAGGAAATACAAGAAAGTGGTCTGGACACAGAAGA

AATCCAGGATTCCCAGGGACCTTTGCAGATGGAAACCCTGGAGGCTCTAGGAGATGAGCCACTGATGTCTCTGAAAACCCAGAACCATGAGACCCCAGGA

AAGGAGAATTGCAATTCATCTATAGAAGAGAACTCGGGGACAGTAAAAAGCCCAGAAAAAGAAAAACAAACACCACTGAAGTCTTTAGAAGAAAAGAATG

TAGAGGCAGAGAAAACTCTAGAAAATGGGGTTCTTGAACTATCTAAACCTTTAGGAGAAGAAGAACCAAGAATGGAGGATCAAGAATTAATGTCTCCTGA

ACACACACTAGAGACAGTTTCATTTCTAGGAAAGGAAAATCAGGAAGTAGTGAGGTCTTCAGAAGAACAGAACTTAGAATCATTGATAACTTTTAAAGAG

GAGAGCCAATACCCACTGGGAGGTCCAGAAGCCGAGGACCAGATGCTTGAAAGACTGGTAGAGAAAGAGGATCAGAGGTTCCCAAGGTCTCCAGAAGAAG

ACCAGCAGGCGTTTAGACCTCTGGAGAAAGAGAATCAGGAGCCACTAAGATTTGAAGAAGCAGAGGACCAGGTGCTTGAGAGACTGATAGAAAAGGAAAG

GCAGGAGTCCCTGAAGTCTCCAGAAGAAGAGGACCAGCAGGCATTTAGACTTCTGGAGAAAGAGAATCAAGAACCACTAAGGTTTGAAGACGCAGAGGAC

CAGGTGCTTGAGAGACTGATAGAAAAGGAAAGACAGGAGTCCCTGAAGTCTCCAGAAGAAGAGGACCAGCAGGCATTTAGACTTCTGGAGAAAGAGAATC

AAGAACCACTAAGGTTTGAAGAAGCAGAGGACCAGGTGCTTGAGAGACTGGTAGAAAAGGAAAGTCAGGAGTCCCTGAAGTCTCCAGAAGAGGAGGACCA

GAGGACTGGGAAGCCTCTAGAAAAAGAAAATCAGGAATCTCTGAGGTCTCTTGATGAAAACCAGGAGACAATTGTACTGCTAGAAAGCAAGAACCAGAGG

CCACTGAGATCTCTAGAAGTAGAAGAGGAGGAGCAGAGAATTGTGAAACCTCTAGAAAAAGTGAGCCAGGTCTCCCTCGAATCTCTCGAAAAAGAGAATG

TGCAGTCACCAAGGTATCTGGAAGAAGATGACCACATGATTAAGAGCCTGCTAGAAGACAAGACTCATGAGATCCTGGGATCTCTTGAAGATAGAAATGG

GGAGAACTTTATACCACCTGAAAATGAGACCCAGGGTTCATTGAGGCCTCCAGAAGAAGAGGACCAGAGGATTGTGAACCATCTAGAAAAAGAAAGCCAG

GAGTTCCTGAGGTCTCCAGAAGCAGAGGAAGAAGAAGAGCAGGTGATGGTGAGATCTCTAGAAGGAGAGAACCACGACCCACTGAGCTCTGTGGTGAAAG

AGGAGCAGATGGCTGAGAGCAAGCTAGAGAACGAGAGTCAGGACTCCAGGAAGTCTCTTGAAGATGAGAGCCAGGAGACCTTTGGGTCTCTGGAAAAAGA

GAATCTAGAGTCCCTGAGGTCTCTAGCAGGACAGGACCAAGAGGAACAGAAACTCGAACAAGAGACCCAGCAGCCACTGAGGGCTGTAGAAGATGAGCAG

ATGACAGTGAACCCTCCAGAAAAGGTGGATCCAGAGTTACCAAAGCCTCTTAGAAATGACCAGGAAGTAGTCAGATCTCTTGACAAGGAGAATCAAGAGT

CACTAGTGTCACTGAATGAAGGAGGTATGGAGACAGTGAAGTCTTCAGAAACAGAGAACATAGAATCACTGGAGACTGTGGGAGAGTGCCTGGGAAGAAG

GAAGTCTGTAGATACTCAAGAGCCATTGTGGTCTACGGAAGTGACTAGTGAGACAATAGAACCTCTAGAAGATGAGACCCAAGAACCACTGGGGTGTGTG

GATGAGAACCAAGAGGTGCTGACACCCCTTGAAAGGGAGAGTCAAGAACTGAGATCTCTGGGCAAGTGGAACCCAGAGACTGTGGAATCACCAGGAGGGG

TGGAGGACAGTCAGCAGTGCCTGGAAGTGGAAGAGGGCCCGGAGAGGGAGCAGCACCAAGAGTCTCTGAGGTCTCTGGGAGAGGTGGAATGGGAGCTGCC

TGGATCTGGAAGTCAACAGAGGTGGGAGGATGTGGTGGAGGATGGAGAAGGTCAGGAAGCATCCCTGGGGGCTACAGGAGTGGAAACTGAGGATAAGGCA

GAGTTGCATCTGAGGGGCCAAGGTGGGGAGGAGAAAGCTGTAGAGGAGGGAGAGCTGCTGCAGGATGCTGTGGGGGAGGCCTGGAGTCTGGGGAGCTCGG

AGCCCAAGGAGCAGAGGGTCCCTGCTGAGCCCCTCGATGACCTGGAGGGACAACCAGAGCAGACGGGAACCCTAGAGGTCCCAGTTGCTCAGGGAATGCC

AGAGGCAACAGAGCAAGATGAGGACAGAGCCCAAGCAGGTGAACAAGACTCCGTAGAGGTGACCCTTGGGTTAGAGGCTGCCAGAGCTGGACTGGAACTC

GAGCAGGAAGTGGTAGGGCTAGAGGACCCAAGGCATTTCGCCAGGGAGGAGGCCATTCACCCATCCCTGGGGGAGGAAAGTGTGAAGGCAAAGATAGATC

AGGGCTTGGAAGAGCCTGGAAAGGAACCAAAAGAGGCAGGTGCTCTGGACTCAGGCATCCCTGAATTACCCAAGACTAGCAGTGAGACTCTGGAATGCAA

GGGCTGGGAAGAGTCTGGGGAGGGCTGGGGAGAAGAGGAGGCCTCGCTGGAGACCTCAGACCATGAGGGCAGCCATGCCCCTCAGCCCAGGCCCCCTAAG

ACAGAGGAAGATGAGGGTCTACAGGCAGCGCTAACAGTCCCTGGTCCCAAGCTCCTGGAACCCTGTTCACCCATCCCGATCTTGACAGATGCCCATGAGC

TGCAGCCCCAAGCTGAGGGGATCCAGGAGGCTGGGTGGCAGCCGGAAGCTGGGACTGAAGCACTGGGAAGAGTAGAAGATGAGCCAGAGTTTGGTCGTGG

GGAGATTCCTGAGGGCCTCCAGGATTGGGAGGAGGGCAGAGAAGACAGTGAGGCAGATGAGTTAGGGGAAACTCTCCCTGACTCTACTCCCTTGGGCCTC

TACCTGAAGTCTCCTGCCTCCCCAAAGTGGGAGCAAGCTGGAGAACAGAGGCTTTTCCCTCAAGGGGAGGCCAGGAAGGAAGGCTGGAGTCCTGCTGCCC

TGGCTGCCCAGGGTCTCAGTGACCCACCAGAGGAAGAGCAGCAAGGCCATGACTCTGACCTCTCATCTGAGGAATTTGAGGACCTAGGGACTGAGGCCTC

TCTTCTTCCAGGGGTTCCCAAAGAGGTGTCCGATCATCTGGGCCAAGAGCCCCCCGTACTGCAGCCTGCATGCTGGGATCAGGGTGGGGAGTCTGATGGG

TTTGCTGATGAGGAAGAGAGTGGGGAAGAGGGAGAGGAAGAAGATGCTGATGAAGAAGAAGGAGCAGAGTCAGGGACTCAGTGGTGGGGGCCAGGGCCCT

CTGGTGGAGGTGTCAAGGTCCAGGATGTCACCCAGAGAGGGGACCTGGAACATGAATCTGTGGGTGACAGTGGCCTCTGGGATGATGGCTTGAGTGGGGC

TGCAGCTAATGTTCTTGTAACTGCCCTAGAGACGGTGTCTCAGGACAGTGCTGAGCCTTCCGGGTCAGAGGGGTCTGAGTCTGCTTCCTTGGAGGGGGAG

GAAGGTCAAGCGATTGACCATTTAGATGCCCCCCAAGAGGTGACTAGCGTGGTCCCAGGGGCAGGAGACACCTTTGATATCAGTGGCCAGGGCCCCAACC

TGGAGTCAGAGCAAGTGAATGGGAGGATGGAGAATGGACTAGAGCAGGCTGAGGGTCAGGTGGTTCTGCATGGGGACGAGGATCAAGGCATCCCTTTACA

GGAACAGGGTACCCTCAAGGCCCCTTTAGTAGGGTCTCCTGTGCATCTAGGCCCAAGCCAGCCGCTGAAGTTCACTCTGAGTGGGGTAGATGGAGACTCC

TGGTCCTCAGGGGAAGATTAGAAACTGCCCCTCTGGCACTGAGGACTTAGTGGGGGGTGGGGGGAATGTCCCTCCCTGCTCTGGGCCAGCACTCTTAGCT

TTGATAACTTGACCTGTGGTATCTCTCGTGGAGAGGTGTGGCTGGCTGAGACAGGTGAGATCCTGCCTGGATCACCCTGAAGGCTCAGGTCAGCTGAGCC

TATAGTTCAACGCCCCCTTTCTTCTGTGGCTCACCTGCTGGAAGAGGCTTGGGCCCAGAGCTTTCCCACGAGACTGCTCTGGCCAGAGCTTGCTAGCCCT

GCCTGTCTACAGTAGCACCACCTGCACAGGGTCTGGTGCATGCCCAGAGGAGCAGCAATGATGAGTGACTCTCATCATCTCAGCCTGCTGAGATCTTGTT

TCTCTCTTCCTCCCTTGAATAAAGCTGTATCCCTACCT
Translation
MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRAQSGDASWRARADDELAALRVLVDQRWREKHEAEVQRDNLAEELESVAGRCQQVRL

ARERTIEEAACSRRALEAEKNARGWLSTQAAELERELEALRASHEEERAHLNAQAACTPRRPPAPAHASPIRAPEVEELARRLGEVWRGAVRDYQERVAH

MESSLGQARERLGQAVRGARESRLEVQQLQADRDSLQERREALEQRLEGRWQDRLQATEKFQ LAVEALEQEKQGLQSQIAQILEGGQQLAHLKMSLSLE

VATYR RTLLEAENSRLQTPGRSSQASLGFPD - UNI30192 - DPKLKLHFLGIPEDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQEFLKAR

TPTLASTPIPPMSEAPYPKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSSTGVLPELEEPGGEQPDHFPDDPTSLAPPLNPHHSILEAKDRESSESR

VSSIFQEEEGQIWELVKKEAATEVKVENSLAQEIQESGLDTEEIQDSQGPLQMETLEALGDEPLMSLKTQNHETPGKENCNSSIEENSGTVKSPEKEKQT

PLKSLEEKNVEAEKTLENGVLELSKPLGEEEPRMEDQELMSPEHTLETVSFLGKENQEVVRSSEEQNLESLITFKEESQYPLGGPEAEDQMLERLVEKED

QRFPRSPEEDQQAFRPLEKENQEPLRFEEAEDQVLERLIEKERQESLKSPEEEDQQAFRLLEKENQEPLRFEDAEDQVLERLIEKERQESLKSPEEEDQQ

AFRLLEKENQEPLRFEEAEDQVLERLVEKESQESLKSPEEEDQRTGKPLEKENQESLRSLDENQETIVLLESKNQRPLRSLEVEEEEQRIVKPLEKVSQV

SLESLEKENVQSPRYLEEDDHMIKSLLEDKTHEILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEAEEEEEQVMVRSLEGEN

HDPLSSVVKEEQMAESKLENESQDSRKSLEDESQETFGSLEKENLESLRSLAGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVV

RSLDKENQESLVSLNEGGMETVKSSETENIESLETVGECLGRRKSVDTQEPLWSTEVTSETIEPLEDETQEPLGCVDENQEVLTPLERESQELRSLGKWN

PETVESPGGVEDSQQCLEVEEGPEREQHQESLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELHLRGQGGEEKAVEEGELLQDAV

GEAWSLGSSEPKEQRVPAEPLDDLEGQPEQTGTLEVPVAQGMPEATEQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHPSLG

EESVKAKIDQGLEEPGKEPKEAGALDSGIPELPKTSSETLECKGWEESGEGWGEEEASLETSDHEGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSP

IPILTDAHELQPQAEGIQEAGWQPEAGTEALGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPLGLYLKSPASPKWEQAGEQRLFPQGEA

RKEGWSPAALAAQGLSDPPEEEQQGHDSDLSSEEFEDLGTEASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDADEEEGAES

GTQWWGPGPSGGGVKVQDVTQRGDLEHESVGDSGLWDDGLSGAAANVLVTALETVSQDSAEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDT

FDISGQGPNLESEQVNGRMENGLEQAEGQVVLHGDEDQGIPLQEQGTLKAPLVGSPVHLGPSQPLKFTLSGVDGDSWSSGED

For any suggestions or comments, please send an email to unitrap@crg.es