Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004894 (Hapln2)
Chromosomal location
Chr 3: 87825983 - 87831362 (-)
Description
hyaluronan and proteoglycan link protein 2 Gene [Source:MGI (curated);Acc:Hapln2]
RefSeq_dna
NM_022031 
RefSeq_peptide
NP_071314.1 
MGI
MGI:2137300 
Uniprot/SWISSPROT
Q9ESM3 
Uniprot/SPTREMBL
B2RRU7 
Human Ortholog
ENSG00000132702 (HAPLN2)
Omim not available
UniTrap UNI21711
Vector Insertion
Chr 3: 87828394 - 87830806
Public Clones not available
Private Clones OST320429 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005014
Sequence
CCCATCTTGACAGCCTCTTCTGAAAGGCCATATATAGCCTGGCACAGAGGGCACAG GACAGGAAGCTGCTGAGCACAGCTCGATTTGCCTCTGAGGAGA

GATCATCTTGCAG - UNI21711 - TACTAGGGAGTGCCCACCACCTGTGCCCTGCAGACGGTGCTTGCTGACACCATCATGCCAAGCAGGATCCCTC

TCCCTGCGTTCTGCTGCTTCCTTCTCCCCTGGGCCTTCACCAGCTTTCACAAAGCCCTGGGGAATCCGG CCCCCCATCCGGGTCCCCACTACCTCCTGC

CCCCCATCCACGAGGTCATTCACTCTCGTCGTGGGGCCACGGCCACACTGCCCTGCGTCCTGGGCACCTCGCCTCCCAGCTACAAAGTACGCTGGAGCAA

AGTGGAGCCCGGTGAGCTGCGGGAAACGCTAATCCTCATTACCAACGGACTGCACGCCCGGGACTACGGGCTCCTGGGAGGGCGCGCCAGCTTGCGGAGA

GGGCATCGGCTGGACGCCTCCCTGATCATCAAGAACGTGCGTCTGGAGGATGAGGGTCGGTACCGCTGCGAGCTCATCAATGGCATTGAGGACGAGAGCG

TGGCACTGACCCTGCGCCTGGAGG GTGTGGTGTTTCCGTACCAACCCAGCCGAGGCCGCTACCAGTTCAATTACTTCGAAGCGAAGCGGGCGTGTGAAG

AGCAGGACGGACGCCTGGCCACTTACGGCCAACTCTACCAGG CGTGGACCGAGGGGCTGGACTGGTGCAACGCCGGCTGGTTGCTCGAGGGCTCCGTGC

GTTACCCTGTGCTCACCGCGCGGGCTCCGTGCGGCGGCCACGGGCGGCCAGGCATCCGCAGCTACGGGCCCCGCGACCGCAGCCGCGACCGCTATGACGC

CTTCTGCTTCACCTCGGCCCTGGCAG GCCAGGTGTTCTTCGTGCCGGGGCGGCTGACGCTGTCAGAAGCCCACGCGGCTTGCCGGAGGCGCGGAGCCGT

AGTAGCCAAGGTCGGGCACCTCTACGCCGCCTGGAAGTTCTCCGGCCTGGATCAATGCGACGGAGGCTGGCTGGCGGACGGCAGCGTTCGCTTCCCCATC

ACGACGCCGCGGCCGCGCTGTGGGGGTCTCCCTGACCCAGGGGTGCGCAGCTTCGGCTTCCCCCGACCCCAGCAGGCGTCCTACGGGACCTACTGCTATG

CCGAGAAGTAGGAGTGCGACAGAGTGGCGGGTCCCCTCTGGACAGACTAAGGCCCAGCCCTCACTTCTGCCTTCCCCAGGCCAGCGCGGTGCTTCGGGCT

GCTGGGCAAAGGGGCGTCCCGGGCATTAACTGACCAATAAAATAACATGGCACCTTCTTTGTTCCATAAGAACAAACATATATTGCATCTATGGCTCAGC

AATATACTGGGTTTGTGATTAGAGAGCACCCACAGCACGAAGGACAGAGGAGAGGAAGGAGGAGAGGAAGTCTCAGCAGACCTGGCCATCTACACGGGAG

AATACAGGCTGCCCTTTATGTCTAACCAGTCACTCAAAGGTTTCTTATTCAAAATTTCCAGGAACTCCAAACTTCCAGAGCTGTCTGGGCCCTACAAAAC

AAATATTCAAACTAAACTCATTTCTAAATGTACTTATCACTTCCAAGGTCTGTTTTATTTAGTTTATTAATTTTATTTATTTATTTTGAGAC
Translation
  - UNI21711 - MPSRIPLPAFCCFLLPWAFTSFHKALGNPA APHPGPHYLLPPIHEVIHSRRGATATLPCVLGTSPPSYKVRWSKVEPGELRETL

ILITNGLHARDYGLLGGRASLRRGHRLDASLIIKNVRLEDEGRYRCELINGIEDESVALTLRLEG GVVFPYQPSRGRYQFNYFEAKRACEEQDGRLATY

GQLYQA AWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGHGRPGIRSYGPRDRSRDRYDAFCFTSALAG GQVFFVPGRLTLSEAHAACRRRGAVVAKVG

HLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQASYGTYCYAEK

For any suggestions or comments, please send an email to unitrap@crg.es