Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000004994 (Ccdc130)
Chromosomal location
Chr 8: 86781694 - 86794259 (-)
Description
coiled-coil domain containing 130 Gene [Source:MGI Symbol;Acc:MGI:1914986]
RefSeq_dna
NM_026350 
RefSeq_peptide
NP_080626.1 
UniGene
Mm.30095 
MGI
MGI:1914986 
Uniprot/SWISSPROT
Q9D516 
Uniprot/SPTREMBL
Q8BN00 Q922B5 
Human Ortholog
ENSG00000104957 (CCDC130)
Omim not available
UniTrap UNI22589
Vector Insertion
Chr 8: 86790974 - 86794240
Public Clones (sanger) 3SD142A07 (ggtc) IST10195E5 (tigm)
Private Clones OST290907 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005120
Sequence
GACGTCAGGGAGAGGGCAG - UNI22589 - GCTCTCCTTGGACATTCCTGTACTCTTTGTAGGCTCCGCATCAGGTTGCAACTCAGAAGTATTGTGA

ACTTCAAGAAATAGGAAGATCCAAGTGACACAGCCACACCTCTACAGAACAGCCGTGTGCGGCCTCTGAGGCTCCACAGGAGGGCACGTCTCACTGCATC

TTCATGCGTTGACCAGGCCAATTTCATAGTTGCAGCCTTGCTAGTGAGGACCTATAGGCAGCTCCCAAGATG GGTGAAAGGAAAGGCCAGAACAAGTAC

TACCCCCCAGACTTCAACCCCGAAAAG CATGGCTCTCTCAACCGATACCACAACAGCCACCCACTTCGAGAACGGGCTCGGAAGCTCTCACAAGGCATC

CTTGTTATCCG ATTTGAAATGCCATACAACATCTGGTGTGACGGCTGTAAGAACCACATCGGCATGG GTGTGCGCTACAATGCAGAAAAGAAGAAGGT

TGGCAACTATTACACGACTCCAATCTACAG GTTCAGGATGAAATGCCACCTCTGTGTCAACTACATCGAGATGCAAACAGACCCTGCCAACTGTGACTA

TGTCATCGTGAGTGGTGCCAGTCGCAAGGAGGAGCGTTGGGACATGGAAGACAACGAGCAGGTGCTGACCACAG AGCATGAGAAGAAAGAGAAGCTGGA

GACGGATGCCATGTTCCGCCTAGAGCATGGTGAGGCTGACCGCAGCACACTGAAGAAGGCCCTCCCCACACTCAGCCACATCCAGGAAGCGCAGAATGCC

TGGAAGGATGACTTCGCTCTGAATAGCATGCTACGGAGGCACTTCCGG CTTATGAGGACAAGCAGCGAATGAAGCGGACAGAGATCATCCACCGCTCTT

GGTTCCCCTCAGCCCAGGGACCCAGTGCTAGCAGCAGCAAAGCTAGCAGCGTCCTGAAGAAGCTGTGCCAGGGCCGCAGACCACCCCCCAGCAGCACAGG

CACGGTGGGGGACCTGGGCATAGTGAGGAGAAAGTCTCGAGACGTTCCAGAAAGTCCTCAGTGTGCAGCAGACAACTCCTTGTCAGAAGAACAAAGAAGG

CCACCAGGAACCACCCAGGGTAGCAAGACACTTGAAGAGGCAGCAGAAGCATCCAGGACCAGCAAGACATCAGAATCCAAGAGAAACTGTAGTGATCAGG

CCTTCCCCCTAGGTTCCTCCCAGGAGGACCTGCTGAACCCCAACACCCCCAATGCCTCCCTGGTGGCTGACTACTCTGACTCAGAGAGCGAGTAAGGGAG

TCAGAATTCCAGGACCAGAAGCCATGACGCGTCCAGACCTTAGGGACTGGCACATTGCTGCCAGCCCAGATACAGACCTACCTTCCTATACAGATTATTA

TTTATTTGGTTTTGGTGAGAATGCCTGTGCCTTGATGTAACCCTGATACCTGAGCATTAAAGTGCTGTTCTTTGTCCCTGCCTTGTTTCTAAACTCATCT

AGTAGCTGCCCTGCCCTCACTTCCAGCCAACTAAGCAGATGCTGCTGCATCGTTGTGACGGCAGTGTGGCCCCACAAAGCCCGATGAAGGGTTTGAGATA

CTGACCAAGATTGGCCACGGCCTGGGGTGACGTCCCCTTATGAGGTGTCAAGGACTACATAAGGAAGGTTGAAAGAGGGCCAGGCTGCTGGAGCCAGAGA

AATAAAGCTAACGGCAGGCAGGAAGAACATCCAAACTCCATGTCATGGGCTGGTGTGGGTCACTCATAGTGGCCAGCCAGTAGGGATGTTTGTGAAACAA

CCTCAAAAACACCCTAATCCAGCCAGGCATAGTGGGCAGACAACCGTCATCCTGGCACCCCAGCAATAGAGACAAGGTGTGGTCCAGCTTTAAAATAGGG

TTTCTCATGTATCCCTGGCTGTCCTGGAACTCGTTCTGTAACTATTGTGGAGCCAGATTCACAAATATATCTCTACCTCCT
Translation
 - UNI22589 - M GERKGQNKYYPPDFNPEK HGSLNRYHNSHPLRERARKLSQGILVIR RFEMPYNIWCDGCKNHIGMG GVRYNAEKKKVGNYY

TTPIYR RFRMKCHLCVNYIEMQTDPANCDYVIVSGASRKEERWDMEDNEQVLTTE EHEKKEKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQNAW

KDDFALNSMLRRHFR LMRTSSE
Transcript ENSMUST00000098578
Sequence
GACGTCAGGGAGAGGGCAG - UNI22589 - GCTCTCCTTGGACATTCCTGTACTCTTTGTAGGCTCCGCATCAGGTTGCAACTCAGAAGTATTGTGA

ACTTCAAGAAATAGGAAGATCCAAGTGACACAGCCACACCTCTACAGAACAGCCGTGTGCGGCCTCTGAGGCTCCACAGGAGGGCACGTCTCACTGCATC

TTCATGCGTTGACCAGGCCAATTTCATAGTTGCAGCCTTGCTAGTGAGGACCTATAGGCAGCTCCCAAGATG GGTGAAAGGAAAGGCCAGAACAAGTAC

TACCCCCCAGACTTCAACCCCGAAAAG CATGGCTCTCTCAACCGATACCACAACAGCCACCCACTTCGAGAACGGGCTCGGAAGCTCTCACAAGGCATC

CTTGTTATCCG ATTTGAAATGCCATACAACATCTGGTGTGACGGCTGTAAGAACCACATCGGCATGG GTGTGCGCTACAATGCAGAAAAGAAGAAGGT

TGGCAACTATTACACGACTCCAATCTACAG GTTCAGGATGAAATGCCACCTCTGTGTCAACTACATCGAGATGCAAACAGACCCTGCCAACTGTGACTA

TGTCATCGTGAGTGGTGCCAGTCGCAAGGAGGAGCGTTGGGACATGGAAGACAACGAGCAGGTGCTGACCACAG AGCATGAGAAGAAAGAGAAGCTGGA

GACGGATGCCATGTTCCGCCTAGAGCATGGTGAGGCTGACCGCAGCACACTGAAGAAGGCCCTCCCCACACTCAGCCACATCCAGGAAGCGCAGAATGCC

TGGAAGGATGACTTCGCTCTGAATAGCATGCTACGGAGGCACTTCCGG GAGAAGAAGAAAGCCATGCAGGAGGAGGAAGAGAAGGACCAGGCACTGCAG

GCAAAAGCCAGCCTAGCCATCCCTCTTGTGCCAGAGTCTGAGGATGACCGCAGGCTGGCTGCCCTGCTAAGGTTGCACACCCTGGACT CTTATGAGGAC

AAGCAGCGAATGAAGCGGACAGAGATCATCCACCGCTCTTGGTTCCCCTCAGCCCAGGGACCCAGTGCTAGCAGCAGCAAAGCTAGCAGCGTCCTGAAGA

AGCTGTGCCAGGGCCGCAGACCACCCCCCAGCAGCACAGGCACGGTGGGGGACCTGGGCATAGTGAGGAGAAAGTCTCGAGACGTTCCAGAAAGTCCTCA

GTGTGCAGCAGACAACTCCTTGTCAGAAGAACAAAGAAGGCCACCAGGAACCACCCAGGGTAGCAAGACACTTGAAGAGGCAGCAGAAGCATCCAGGACC

AGCAAGACATCAGAATCCAAGAGAAACTGTAGTGATCAGGCCTTCCCCCTAGGTTCCTCCCAGGAGGACCTGCTGAACCCCAACACCCCCAATGCCTCCC

TGGTGGCTGACTACTCTGACTCAGAGAGCGAGTAAGGGAGTCAGAATTCCAGGACCAGAAGCCATGACGCGTCCAGACCTTAGGGACTGGCACATTGCTG

CCAGCCCAGATACAGACCTACCTTCCTATACAGATTATTATTTATTTGGTTTTGGTGAGAATGCCTGTGCCTTGATGTAACCCTGATACCTGAGCATTAA

AGTGCTGTTCTTTGTCCCTGCCTTGTTTCTAAACTCATCTAGTAGCTGCCCTGCCCTCACTTCCAGCCAACTAAGCAGATGCTGCTGCATCGTTGTGACG

GCAGTGTGGCCCCACAAAGCCCGATGAAGGGTTTGAGATACTGACCAAGATTGGCCACGGCCTGGGGTGACGTCCCCTTATGAGGTGTCAAGGACTACAT

AAGGAAGGTTGAAAGAGGGCCAGGCTGCTGGAGCCAGAGAAATAAAGCTAACGGCAGGCAGGAAGAACATCCAAACTCCATGTCATGGGCTGGTGTGGGT

CACTCATAGTGGCCAGCCAGTAGGGATGTTTGTGAAACAACCTCAAAAACACCCTAATCCAGCCAGGCATAGTGGGCAGACAACCGTCATCCTGGCACCC

CAGCAATAGAGACAAGGTGTGGTCCAGCTTTAAAATAGGGTTTCTCATGTATCCCTGGCTGTCCTGGAACTCGTTCTGTAACTATTGTGGAGCCAGATTC

ACAAATATATCTCTACCTCCT
Translation
 - UNI22589 - M GERKGQNKYYPPDFNPEK HGSLNRYHNSHPLRERARKLSQGILVIR RFEMPYNIWCDGCKNHIGMG GVRYNAEKKKVGNYY

TTPIYR RFRMKCHLCVNYIEMQTDPANCDYVIVSGASRKEERWDMEDNEQVLTTE EHEKKEKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQNAW

KDDFALNSMLRRHFR EKKKAMQEEEEKDQALQAKASLAIPLVPESEDDRRLAALLRLHTLDS SYEDKQRMKRTEIIHRSWFPSAQGPSASSSKASSVL

KKLCQGRRPPPSSTGTVGDLGIVRRKSRDVPESPQCAADNSLSEEQRRPPGTTQGSKTLEEAAEASRTSKTSESKRNCSDQAFPLGSSQEDLLNPNTPNA

SLVADYSDSESE

For any suggestions or comments, please send an email to unitrap@crg.es