Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005103 (Wdr1)
Chromosomal location
Chr 5: 38918192 - 38952941 (-)
Description
WD repeat domain 1 Gene [Source:MGI Symbol;Acc:MGI:1337100]
RefSeq_peptide
NP_035845.1 
MGI
MGI:1337100 
Uniprot/SWISSPROT
O88342 
Uniprot/SPTREMBL
Q3TE06 Q3TJY2 Q3TNK2 Q3U136 Q80ZI9 Q9DBM8 Q9DC08 
Human Ortholog
ENSG00000071127 (WDR1)
Omim not available
UniTrap UNI14189
Vector Insertion
Chr 5: 38952441 - 38952754
Public Clones CMHD-GT_25E8-5 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1301
Vector Insertion
Chr 5: 38942707 - 38952318
Public Clones DC0345 (sanger) (sanger) AC0796 (sanger) XN462 (baygenomics) RRK213 (baygenomics)
CMHD-GT_25C3-5 (cmhd) IST14722D5 (tigm) IST10061D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23984
Vector Insertion
Chr 5: 38938331 - 38942615
Public Clones not available
Private Clones OST238533 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005234
Sequence
GTTGGGTTGTCCGCAGCGGTAGCGCGCGGGGCAGGCGCGTACGGGTCTCGGAGCCGGGTCTCGGACCGCCCCCTCCGCGCCCGGCACGCCCGGCGCCGCC

TTCCGCGCTGTCCCTGGGCTCGGCCACTGCGAGGTTCCACTCGAGCGCAGCGCCGTAACAAGTGGGCGAGGATGCCGTACGAGATCA - UNI14189 -

 AGAAGGTGTTCGCCAGCCTCCCCCAGGTGGAGCGGGGCGTCTCTAAGATCCTCGGTGGAGACCCCAAGGGCGATCATTTCCTCTACACCAATGGCAAGT

GCGTCATCCTAAGAAACATCGAT - UNI1301 - AACCCTGCTATTGCTGATATCTACACAGAACATGCCCATCAAGTGGTAGTAGCCAAGTATGCAC

CCAGCGGATTCTACATTGCTTCTGGAG - UNI23984 - ACATCTCTGGGAAGCTAAGGATCTGGGATACCACACAGAAGGAGCATCTTCTAAAGTAT

GAGTACCAGCCTTTCGCTGGGAAGATCAAGGACATTGCCTGGACGGAAGACAGTAAGAGGATCGCCGTGGTCGGGGAAGGAAGGGAGAA GTTTGGAGCT

GTCTTCTTATGGGACACTGGCTCTTCTGTGGGTGAGATCACAGGACACAACAAAGTCATCAACAGTGTGGACATAAAGCAGACCAGGCCCTACCGACTAG

CAACAGGGAGTGATGATAACTGTGCTGCGTTCTTCGAGGGCCCTCCATTCAAGTTCAAGTTCACAATTGGT GACCACAGCCGCTTTGTCAACTGTGTGC

GATTCTCTCCTGATGGGAACAGATTTGCCACAGCTAGCGCTGATGGCCAG ATTTTCATTTATGATGGGAAGACGGGAGAGAAGGTGTGTGCCCTTGGAG

AAAGCAAGGCCCATGATGGAGGAATTTATGCC ATTAGTTGGAGTCCTGATAGCACTCATTTGCTATCTGCCTCTGGAGACAAAACCTCTAAGATTTGGG

ATGTCAATGTAAACTCTGTGGTCAGCACGTTTCCCATGGGCTCCAATGTTCTGGACCAGCAGCTGGGCTGCCTCTGGCAGAAGGACCACCTCCTCAGCAT

CTCCCTGTCTGGATACATCAACTACCTGGACAAGAACAACCCCAGCAAACCCCTCCGGGTCATCAAG GGTCACAGTAAATCCATCCAGTGTCTGACCGT

GCACAGAAATGGTGGCAAGTCCTACATCTATTCTGGGAGCCATGATGGACATATCA AGACAGGAGAGAATGACTCCTTCTCTGGAAAAGGCCACACAAA

TCAGGTGTCCAGGATGACTGTGAATGAGTCTGAGCAGTTGGTCAGCTGCAGCATGGATGACACAGTGCGGTACACCAACCTCACACTGAGGGACTACAG 

TGGACAAGGCGTTGTGAAACTGGATGTTCAACCAAAGTGTGTAGCTGTTGGCCCTGGGGGATATACTGTGGTCGTGTGCATTGGACAG ATTGTCCTTCT

GAAGGACCAGAAGAAGTGCTTCAGCATCGACAACCCTGGCTACGAGCCTGAAGTCGTCGCTGTGCACCCTGGTGGGGACACAGTGGCTGTTGGTGGCACG

 GATGGCAATGTGCGTGTGTACTCCATCCTGGCCTCCACACTAAAGGATGAAGGCAAACTCCTAGAGGCCAAGGGACCAGTAACAGACGTGGCCTACTCT

CATGATGGTGCCTTCCTGGCTGTGTGTGATGCCAGCAAGGTGGTCACAGTATTCAGTGTAGCTGATGGCTATTCG GAGAATAATGTTTTTTATGGACAC

CATGCAAAAATTGTGTGCCTGGCCTGGTCACCAGATAATGAACACTTTGCCTCTGGCGGCATGGATATGATGGTGTACGTCTGGACGCTGAGTGACCCAG

AGACCAAAGTCAAGATCCAAG ATGCTCACCGGCTGCACCACGTCAGCAGCCTGGCCTGGCTAGACGAACACACACTGGTCACCACCTCCCATGACGCCT

CTGTGAAGGAGTGGACAATCACCTACTGAGGACGCCGCTCACCCCAAGGACCGAATCAGGGACTAGAGTTTAACTGCCTCAGAGCACCCTTCTCTTAACT

ATTTCTCTAACGCTCCCCTTCCTGCCTGCTCTGGGAGTAGGGAGGGCCTACGAGTACCCTCCTCTCTTCAGGGTGTCCGTGTCTGTACGCGTCCTTCTGA

GAGCTTTAGACAGTTACAGTTTGCACATGAGAAATAAAGCAAGCACTTAAACAGCATGTGGAGCGTACCTAAAACCTTACAGCCCACCAGACCATGAGAG

CGTGGAACATTCCAGAGGCAGCAGCCTCCAAAGCACAGACCCAAGCCCCTGTGGCTCTTGCAGCTTCTCAGGAGGCTGGGTAGGGAGCAGGCCAGGGCTC

CCCTTCCCCATGCAGGATGCATTTGCACTGGAGAGGAGGAGCCGCTCTACAGCCGCCAGCATTCTGTGTAGAGCAGGTCTGTTTCTCGGTGTAAGTCATG

TCACATGGCTGCCTCCCTGGACCCATCCCCAGATCCCATGGGGACATGTGAACCTTGATCTCATTGTCAGATTTTGTGCTTGATTTTTAAGAATGGAATC

ATGGGAATTTTTTTCTTTTTTTTTTTTTAATGTATCTTGACTGTTGTCTGTCTTGTTCCTGACCTGGCACGCTGACAGTACCTTGTCCAGATAAGTAGAG

CCCTTGTTAGCCAGACTGAGGTGTCCTGGTCACGTGATTACCATGCTTCAGTGTTTCCCTGTCTCTTCCCAACTCTGGCCCCAAGAGCAGAGATTAAGGA

CAAGAAGATGTTACTGTAATTTGTCATGTTTTTACCTTTTTTTTTCTTTTTCAGTGCAGAAATTAAAGTAAGTATAAAGCCC
Translation
VGLSAAVARGAGAYGSRSRVSDRPLRARHARRRLPRCPWARPLRGSTRAQRRNKWARMPYEIK - UNI14189 - KKVFASLPQVERGVSKILGGDPK

GDHFLYTNGKCVILRNID - UNI1301 - NPAIADIYTEHAHQVVVAKYAPSGFYIASGD - UNI23984 - DISGKLRIWDTTQKEHLLKYEYQP

FAGKIKDIAWTEDSKRIAVVGEGREK KFGAVFLWDTGSSVGEITGHNKVINSVDIKQTRPYRLATGSDDNCAAFFEGPPFKFKFTIG DHSRFVNCVRF

SPDGNRFATASADGQ IFIYDGKTGEKVCALGESKAHDGGIYA ISWSPDSTHLLSASGDKTSKIWDVNVNSVVSTFPMGSNVLDQQLGCLWQKDHLLSI

SLSGYINYLDKNNPSKPLRVIK GHSKSIQCLTVHRNGGKSYIYSGSHDGHIK KTGENDSFSGKGHTNQVSRMTVNESEQLVSCSMDDTVRYTNLTLRD

YS SGQGVVKLDVQPKCVAVGPGGYTVVVCIGQ IVLLKDQKKCFSIDNPGYEPEVVAVHPGGDTVAVGGT DGNVRVYSILASTLKDEGKLLEAKGPVT

DVAYSHDGAFLAVCDASKVVTVFSVADGYS ENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETKVKIQD DAHRLHHVSSLAWLDEHTL

VTTSHDASVKEWTITY

For any suggestions or comments, please send an email to unitrap@crg.es