Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005237 (Dnahc2)
Chromosomal location
Chr 11: 69234311 - 69362610 (-)
Description
dynein, axonemal, heavy chain 2 Gene [Source:MGI (curated);Acc:Dnahc2-001]
RefSeq_dna
NM_001081330 
RefSeq_peptide
NP_001074799.1 
UniGene
Mm.247478 
MGI
MGI:107731 
Uniprot/SWISSPROT
P0C6F1 
Human Ortholog
ENSG00000183914 (DNAH2)
Omim not available
UniTrap UNI18325
Vector Insertion
Chr 11: 69357878 - 69358059
Public Clones not available
Private Clones OST425655 (lexicon) OST33014 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31284
Vector Insertion
Chr 11: 69357878 - 69362611
Public Clones IST13489B12 (tigm) IST13937A12 (tigm) IST13950E1 (tigm) IST14073D5 (tigm)
IST14986C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24175
Vector Insertion
Chr 11: 69300836 - 69305004
Public Clones not available
Private Clones OST232177 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34637
Vector Insertion
Chr 11: 69292946 - 69296879
Public Clones IST11111A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22594
Vector Insertion
Chr 11: 69279302 - 69286853
Public Clones IST13150F9 (tigm) IST12547D12 (tigm) IST10593D12 (tigm) IST13765C5 (tigm)
IST14280E9 (tigm) IST14957H2 (tigm) IST14448G6 (tigm)
Private Clones OST290745 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32991
Vector Insertion
Chr 11: 69234310 - 69234923
Public Clones IST14406E1 (tigm) IST14217E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108659
Sequence
TCTGGTTCTCACGGAACTGGTCCAGGGCAGGGTCAGCAGGGCGGTTGCTGGCACAGAGGCCCCGTCTCCCACACTGATCCCTCTCTCCTAATGGATACTC

AGGTCAGCCAGTGGCGG - UNI18325 - - UNI31284 - GTTTTGCCTTCAAGATGGCTAGCAAAGCCGAGAAGAAGCGAAAAGTGGCTGGCCGG

GGAGGCGCCCGGGCAGGCCGAGTTGTCCGAGCTCCTCAGTCCACTGCAGGCCCAGGAGCTACAGAGGCTTCCCTGCTCCCTGATGGTCAGGAGCCAGAGC

CCGAGTCTGGCAAGGAGGACTCTG - UNI18325 - - UNI31284 - TGCTGGGATTACAGGCATTTGCCAGCTGGAGATTGACCCCAGCGCTTCA

TGGAGAGGCTAACACTCCACCAACTCTGCTGCATCCCCAGCCCCTGTTTCACAGACGTCTTACAACTTTGAATCTTATTCTGTCCTGTTCTAGAGCTGGA

ACTCGGGATCTTGCTCTG AAGCCCTTCTTCCTCTCACGAACGATGTTGACCGGACTGGCAGATGCCACGTGGACGGGGGAGCACGACATGGTTCTGGAG

CACTTTGTCCAGGATCCTGCGGTGCCTGCCCTCACCATCTTCATTGACCCCGTCTTTGGGTTGAAGCTGGAGCTGGGCATGCCTGTGCAG ACGCAGAAT

CAGATTGTGTACTTCATTCGACAAGCCCCAGTTCCCATCACCCCAGAGAACTTCGAGGAGACTGTGCAGTATGGGACGGTGCGGGGTGCCTACATCCCGG

CTTTGCTCCGGCTGCTCAGCGGTGTCTACGTCCCCCAGATTTTTATGAATAAGTCTTGGCCTGAGAGCATCCGGAATCATTTTGTTTCACACCTGCATAG

GTTTTTGGCCTCTCTGACAG ATACTCGCTACAAGCTGGAGGGTCACACGGTACTGTACATCCCTGCAGAGGCCGTACAGATGGACCCTGAGGTGGTGGT

AAAGGACAAAGAGCTGGTACAGCGGCTAGAGA CCTCCATGATCCACTGGACGAGGCAGATCAAGGAAGTGCTGAGTGCCCAGGAGTCTGTGGAGACCGG

AGAGAACTTAGGCCCTTTGGAGGAGATCGAGTTCTGGCACAATCGCTGCATGGACCTGTCCAGCATCAGCAAGCAGCTGGTGAAGAAGGGTGTGAAACAC

ATCGAGTCCATCCTGTTTCTGGCCAAGTCATCCTACTTGACGCCCTTCAGGAAGCTGGCCCAGCAGATCCAG GATGGCTCTCGACAAGCTCAGTCCAAC

CTGACTTTCTTGTCCATCCTGAGGGAACCCTACCAGGAGTTGGCCTTCATGAAGCCTAAGGACATCTCTGAGAAGCTCCCGAAGCTGATCAGCCTCATCC

GAATCATCTGGGTCAACTCCCCCCACTACAACACTCGGGAAAGGCTGACGGCGCTGTTCCGGAAG GTATGCGAATGTCAGTACCACTTTGCCCGTTGGG

AAGACGGCAAGCAAGGTCCCCTTCCATGCTTCTTCGGTGCCCAGGGGCCACAGATCACACGAAACTTGCTAGAAATCGAGGACATCTTTCATAAAAATCT

GCAAACGCTGCGAGCCGTGCGTGGCGGCATCCTGGATGTTAAGAACACCTCTTGGCACGAAGACTACAACAA ATTCCGTGGTGGTATCAAGGACCTGGA

GGTGATGACCCAGAATCTGATTACCTCGGCCTTTGAGTTGGTCCGGGACGTAGAGCACGGAGTGCTGCTCTTGGACACTTTCCACAGGCTGGCCACTCGG

GAG GCCATCATGCGAACCTATGAGAAAAAGGCTGTCGACCTCTACATGCTGTTCAATAGTGAGTTAGCCCTGGTGAACCGGGAGCTGAACAAGAAATGG

CCATATCTGGAGCCATACATGACTCAGTACTCTGGACAGGCCCACTGGGTGCGGATCCTTCGGCGACGCATAGACAGAGTCATGAAC TGCCTTTCCGGA

GCCCACTTCCTGCCCCATATTGGGACTGGCGAGGAGAGCATACATACCTATCAGCAGATGGCTCAAGCCATTGATGAAATGGTTCGAAAAACCTTCCAAG

AGTGGACAGCGACGCTGGACAAGGACTGCATTCGGCGACTGGACATGTCACTGTTACGAATTAGCCAGGAGAAAGTGGGCATGCTGGATGTCAACTTTGA

CAA GACACTCCTGATTCTCTTTGCGGAGATTGACTACTGGGAGCGGCTGCTGTTTGAGACACCGCACTACGTGATGAACGTGGCTGAACGCGCCGAGGA

CCTGCGCATTCTCCGGGAGAACCTGCTCCTTGTTGCTCGAGACTATAACAG GATTATTGCCATGCTGTCCCCAGACGAGCAGGCCCTGTTCAAAGAGCG

GATCCGGTTCCTGGATAAGAAGATCCACCCTGGACTGAAGAAGCTGAATTGGGCCCTGAAGGGGGCCAGTGCCTTCTTCATCACCGAGTGCCGCATGCAT

GCCAGCAAG GTGCAGATGATTGTGAACGACTTCAAGGCCTCCACCCTGACCATCGGCTGGAAGGCCCAGGAGATGTCGGAACTGCTGCTGGTGCACATC

ACTGGCAAGCAGGTGTACAGGGACCTGGAGTTCGAGGAGGCCCAGAGAGAGCACCGGATGGCCGCACAGCAAAAGCTGGTGAAGCTGCACCAAGATGTGG

TGAACATCATGACCAACTCCTACGAAGTGTTCAAGAACGATGGCCCCGAG ATTCAGCAGCAGTGGTTGCTCTACACCATACGGCTGGATCACATGATGG

AGGACGCCCTGCGCCTGAACGTGAAGTGGTCACTGCTGGAGCTTTCCAAGGCCATCAACGGGGATGGAAAGACCACTCCAAACCCGCTCTTCAGGGTCCT

TGTCATTTTACAGAATGATGTGCGGGGAGGTGGGTCACAG GTGGAATTCTCCCCGACTCTGCAGACTCTGGCGAGTGTGGTCAATGACATAGGCAGCCA

CCTCTTTGCCACCATCTCTGTCTTCCGCCACCTCCCCGACATCCTCACCAAACGCAAGATGAATCGAGAGCCCATTTATGTACTTGTGG AGCGAGACGA

GGACATCAGGAAGATCCAGGCCCAGATCAGCAGTGGCATGACTAACAATGCGAGCCTGCTGCAGAATTACCTCAAGACCTGGGACATGTACCGGGAGATC

TGGGAGATCAACAAGGACTCCTTCATTCGCCGCTACCAGCGCCTCAACCCCCCTGTCTCCTCTTTTGATGCTGACATTGCCCG CTACACGGAGGTGGCG

AACAATGTGCAGAAGGAAGAGACGGTCCTCAACATCCAGTTCGTGATGCTGGACTGCTCTCACCTCAAGTTCTCGCTGGTGCAGCACTGCAACGAGTGGC

AGAACAAGTTCACAACCCTGCTCAAGGAGATGGCAGCTGGGCGCCTTGCGGACCTGCACTCCTACCTCAAGGACAATGCTGAAAA AATCAGCCACCCTC

CCCAGACGCTGGAGGAGCTAGGGGTCAGCCTGCAGCTCATGGACACCCTGCAGCATGACCTACCCAACCTGGAGACTCAGATCCCCCCCATTCACGAGCA

GTTTACCATTTTGGAGAAGTATGAGGTGCCAGTTCCGGACACT GTCCTGGAGATGCTGGAGAGCCTCAATGGGGAGTGGCTCACCTTCCAACAAATCCT

GCTGGATAGCGAGCAGATGCTGAAGAAACACAAGGAGAAGTTCAAGACAGGCCTTATCCATGCCGCCGATGACTTCAAGAAGAAGGCACACAACCTTCTA

GAAGACTTTGAGTTCAAAG GGCCGTTTACCAGCACCGTGGGCCACACGGCTGCACTGGATCAGATCGCACAGATGCGCGCCATGCTGATGGCCATGCGG

GACGAGGAGAACAACCTCCGCTCCAATCTGGGCATCTTCAAGATCGAGCAGCCGGTCTCCAAGGACCTCCAGATCCTGGAGAAG - UNI24175 - GA

GCTCGATGCCCTCCAGCAAGTGTGGGAGATCACCCGGGACTGGGAGGAGAGCTGGAACCAGTGGAAGATGGGCTGCTTCCAGACCCTGCAGACGGAAGCC

ATGGAGTCCATGGCTCATGGGCTGTTCCGCCGCCTCACGAGACTAGCCAAAGAGTACAAG GACCGAAACTGGGAAATCATTGAAACGACTCGCTCCAAA

ATAGAGCAGTTCAAGAGGACCATGCCCCTCATCTCAGACCTGCGGAATCCAGCCCTCAGAGAGAG GCACTGGGACCAGGTCAAAGAGGAAGTCCAGCGG

GAGTTTGATCAGGAGTCAGAGAGCTTCACCTTGGAGCAGATTGTGAAACTAGGGATGGATCAGCACGTGGAGAAGATTGCAGAGATCTCAGCCTCTGCGA

CCAAAGAGCTGGCCATAGAAGTG GGATTACAAAATATTGCCAAGACCTGGGATTCGACTCAGCTAGACATAGTACCCTACAAGGACAAGGGCCATCACC

GGCTCAG GGGAACAGAGGAAGTGTTCCAGGCACTGGAAGATAATCAGGTGGCCCTGTCAACCATGAAGGCATCTCGATTCGTGAAGGCCTTTGAGAAGG

ATGTGGACCACTGGGAGCGCTGCCTCTCTCTCATTCTGGAAGTTATTGAGATGGTCCTCACTGTGCAGAGACAGTGGATGTACCTAGAG AATATCTTCC

TTGGAGAGGACATCCGGAAACAGCTGCCCAATGAGTCAGCCCTATTTGACCAGGTCAACAACAACTGGAAAGCCATCATGGACCGAATGAACAAAGACAA

TAACGCTCTCCGGAGCACCCACTACCCAG GACTCCTGGAGACACTGATAGAAATGAACGCAATCCTGGAGGACATTCAGAAGTCCCTGGACATGTACTT

AGAGACCAAGCGCCACATATTCCCCCGCTTCTACTTCCTGTCCAATGATGACCTGCTGGAGATCCTGGGCCAGTCCCGTAACCCAGAGGCTGTGCAGCCA

CACCTCAAAAAGTGCTTTGACAACATCAAACTGCTGAAAATTCAAAAG GTCGGGGGCTCCAGCAGCAAGTGGGAGGCAGTGGGAATGTTCTCAGGTGAC

GGTGAATACATTGACTTCCTCCACCCAGTACTTCTAGAAGGACCAGTGGAG TCGTGGCTTGGTGATGTGGAGCGGGCCATGAGGATGACCCTTCGGGAT

TTGCTTCGAAACTGCCGCGTGGCCCTCAAGAAGTTCCTCAACAAGAGAGACAAATGGGTGAAAGACTGGGCTGGCCAG GTGGTGATCACTGCTAGTCAG

ATCCAGTGGACAGCTGATGTCACCAAGTGCCTGATGACAGCCAAAGAGCGATCAGACAAGAAAATCCTCAAGGTCATGAAGAAGAAGCAG GTGTCAATA

CTAAATAAGTATTCAGAGGCCATCAGGGGGAACTTGACCAAGATCATGAGACTTAAGATTGTGGCTCTGGTGACGATAGAAATTCACGCCCGCGACGTGC

TGGAAAAGCTCTACAAGAGCGGCCTCATGGATGTCAGTTCCTTTGACTGGCTCAGCCAGCTGCGCTTCTACTGGGAGAAG GATGTGGATGACTGTATAA

TCCGCCAGACCAACACACAATTCCAATATGGTTATGAGTACTTGGGGAACTCTGGTCGGCTGGTCATCACTCCCCTGACAGACAG ATGTTACATGACAT

TGACCACGGCACTGCACCTTCATCGCGGGGGCTCCCCCAAAGGCCCAGCAGGTACTGGAAAGACAGAAACTGTCAAAGACCTGGGCAAGGCGCTGGGTAT

ATATGTCATCGTGGTCAACTGCTCCGAGGGCTTGGACTATAAGTCCATGGGAAGAATGTACTCAGGACTGGCACAG AGTGGAGCCTGGGGCTGCTTTGA

CGAGTTTAACCGCATCAACATTGAGGTGTTGTCCGTGGTGGCCCAGCAGATCCTGTCCATCCTATCTGCCTTGACTGCCAACCTCACACGTTTCTATTTT

GAGGGCTTTGAAATAAATCTGGTGTGGTCTTGTGGGATCTTCATCACCATGAATCCTG GCTATGCCGGCCGCACAGAGCTTCCAGAGAACCTAAAGTCC

ATGTTCCGCCCAATTGCCATGGTGGTGCCTGATTCTACGCTTATTGCGGAAATCATTCTCTTTGGGGAGGGCTTTGGCAACTGCAAG ATCCTGGCCAAG

AAGGTGTACACACTGTACTCACTGGCTGTGCAGCAGCTCTCCAGACAGGACCACTACGACTTCGGCCTGCGCGCCCTCACTTCCCTGTTGCGCTATGCTG

GCAAGAAGCGTCGCCTACAGCCAGATCTGTCTGATGAAGAG GTTCTGCTGCTCTCCATGAGAGACATGAACATCGCCAAGCTGACGTCAGTGGATGTCC

CATTGTTCAATGCTATTGTGCAGGACCTCTTCCCCAACATCGAGCTCCCGGTCATTGACTATGGCAAG - UNI22594 - CTACGGGACACCATCGAG

CAGGAGATCCGAGAAATGGGCCTGCAGATCACACCCTTTACCCTCACCAAGGTTTTACAGTTGTACGAAACCAAGAACTCTCGCCACTCCACCATGATTG

TGGGTGGCACCGGCAGCAGCAAGACCACCTCCTGGAAAATTCTGCAGGCCTCTCTGACGTCCCTGTGCCGTGCTGGAGAACCCAACTACAACATCGTTAG

A GAGTTCCCTTTGAACCCAAAGGCACTGTCCTTAGGGGAGCTGTATGGCGAGTATGACCTCAACACCAACGAATGGACCGATGGCATCCTGTCTAGTGT

CATGCGGGTTGCCTGTGCAG ATGAGAAGCCAGACGAGAAATGGATCCTTTTTGATGGCCCCGTGGACACGCTGTGGATCGAGAGCATGAACTCTGTCAT

GGACGATAACAAAGTGCTGACCCTTATCAATGGCGAGCGCATTGCGATGCCCGAGCAG GTGTCTCTCTTGTTTGAAGTGGAGAACTTGGCTGTGGCCTC

TCCAGCCACTGTGTCCCGCTGTGGGATGGTCTACACTGACTATGTGGACCTGGGCTGGAAGCCTTATGTTCAGTCATGGCTGGAAAAGAGGCCAAAG AC

AGAAGTAGAGCCGCTTCAACGCATGTTTGAAAAGTTCATCAACAAGATACTGAGCTTCAAAAAGGATAACTGTAATGAGCTGGTACCTGTCCCCGAGTAC

AGTGGGATCATCTCCCTCTGTAAGCTCTACACAGTCCTGGCCACACCTGAGAATGGG GTGAACCCAGCCGATGCCGAGAACTACTCCTTTATGGTGGAG

ATGACCTTTGTGTTCAGCATGATCTGGTCTGTGTGTGCCTCTGTGGACGAGGACGGACGCAAGAAGATTGACAGCTACCTTCGAGAAATCGAGGGCTCCT

TTCCCAATAAG GACACAGTGTATGAATACTACGTGAACCCCAAGATGCGGACTTGGACGTCATTTGAGGAGAAGCTCCCCAAGAGCTGGCGTTATCCTC

CCAA CGCCCCTTTCTATAAGATCATGGTACCTACTGTTGATACTGTGCGGTATAACTACTTAGTGAGCACCCTGGTGGCCAACCAGAATCCTGTCTTAC

TGGTGGGTCCTGTGGGAACTGGAAAGACCTCCATAGCCCAGAGTGTTCTCCAGTCCTTGCCCTCCAGCCAGTGGTCAGTGCTCGTCGTCAACATGTCCGC

ACAG ACCACGTCAAACAATGTGCAGAGCATCATTGAGAGCAGAGTAGAGAAGCGGACCAAGGGTGTGTATGTGCCATTCGGGGGCAAAAGCATGATTAC

TTTTATGGATGACCTAAACATGCCTGCCAAGGACATGTTTGGGTCCCAGCCGCCCCTGGAGCTGATTCGCCTCTGGATTGACTACGGCTTCTGGTACGAT

CGTGTGAAGCAGAGCATCAAGCACATCCGA GACATGTTCCTGATGGCTGCCATGGGCCCTCCTGGGGGTGGACGGACTGTTATCTCCCCAAGGCTGCAG

AGTCGCTTCAACATTATCAACATGACCTTCCCCACG GAATCCCAGATCATCCGCATATTTGGCACCATGATCAACCAGAAGCTCCAGGACTTTGAAGAA

GAGGTGAAGCCCATTGGGAATGTGGTAACAGAGGCCACCCTGGACGTTTACAATACGGTGGTACAGCGCTTCCTGCCCACCCCGGCGAAGATCCATTACC

TCTTCAACCTCCGGGACATCTCCAAG GTCTTCCAGGGCATGCTTAGAGCCAACAAGGACTTTCATGATACCAAAGCCAGCATCACAAGACTCTGGATTC

ATGAGTGTTTCAG AGTCTTCTCTGACAGACTGGTCGATACAGCAGACATGGAAGCCTTTATGGGCATCTTAAGTGACAAACTCGGTACCTTCTTTGACC

TCACGTTTCATCATCTCTGTCCCAACAAACGCCCTCCCATCTTTG GGGACTTCCTGAAGGAGCCCAAGGTCTATGAAGACCTGGTAGACCTGACAGTAT

TGAAGACAGCCATGGAGACGGCCCTGAATGAGTACAATCTGTCTCCTTCGGTTGTGCCAATGCAGCTGGTGCTCTTCCGAGAGGCCATTGAACACA TCA

CTCGGATCGTGCGTGTGATCGGACAGCCCCGAGGCAACATGTTGCTGGTGGGGATCGGGGGCAGCGGGAGGCAGAGTCTGGCCCGCTTGGCGTCTTCCAT

CTGCGATTATAACACGTTCCAGATCGAGGTCACCAAGCACTACCGCAAACAGGAGTTCCGAGACG ATATCAAGCGCTTGTATCGACAGGCAGGGGTAGA

ACTCCAGACCACGTCTTTCCTTTTCGTGGACACCCAGATAGCTGACGAATCCTTCCTGGAAGACATCAACAACATCCTTAGCTCGGGCGAAGTCCCCAAT

CTCTACAAGTCTGACGAATTTGAAGAG ATCCAGAACCATATCATAGACCAGGCCCGGGCAGAACAGATACCAGAATCCTCGGACAGCCTCTTTGCATAC

CTCATCGAGCGCGTGCGGAACAACCTGCACATTGTGCTCTGTCTAAGTCCCGTGGGAGACCCCTTCAG GAATTGGATTCGCCAGTACCCAGCCTTAGTA

AACTGTACAACCATCAACTGGTTCTCAGAGTGGCCCCGAGAGGCCTTGCTAGAGGTGGCTGAGAAGTACATTATAGGAGTGGACTTGGGGACACAGGAGA

AT ATCCACAGGAAAGTGGCCCAAATCTTTGTCACCATGCACTGGTCAGTGGCTCAGTATTCCCAGAAGATGCTGTTGGAACTGCGGAGATACAACTATG

TCACACCCACAAACTACCTGGAGCTCGTGTCTGGATATAAAAA GCTTCTGGGAGAAAAGCGGCAGGAGCTGCTGGACCAAGCCAATAAGCTTCGAACTG

GATTGTTTAAGATTGACGAAACTAGGGAGAAAGTCGAAGTGATGTCCTTGGAGCTGGAGGACGCCAAGAAAAAAGTGGCAGAGTTCCAGAAGCAGTGCGA

AGAATACCTGGTCATCATTGTGCAGCAGAAGCGGGAAGCAGATGAGCAGCAGAAG GCCGTCACTGCCAATAGTGAGAAGATCGCTATTGAGGAGGTCAA

GTGCCAGGCGCTGGCCGACAATGCCCAGAAGGATCTAGAGGAAGCATTGCCCGCCCTTGAAGAAGCCATGCGG GCCCTAGAGTCTCTGAACAAGAAGGA

CATAGGTGAGATCAAGTCCTACGGACGACCCCCTGCGCAGGTGGAAATTGTAATGCAGGCAGTCATGATTCTTCGAGGCAATGAGCCCACGTGGGCAGAA

GCAAAGCGACAGTTAG GGGAGCAGAACTTCATCAAGTCATTGATCAACTTTGATAAAGACAACATCTCAGATAAGGTATTGAAGAAGATCGGGGCCTAC

TGCGCCCAGCCCGACTTCCAGCCTGATATCATTGGCAGAGTCTCCCTGGCTGCTAAGTCCCTCTGCATGTGGGTGCGGGCCATGGAG TTGTACGGGCGT

CTGTATCGAGTGGTAGAGCCTAAGCGGATCCGAATGAACGCCGCCATGGCCCAGCTTCAGGAGAAGCAAGCAGCCCTAGCTGAAGCCCAGGAAAAGCTGC

GAGAG GTGGCAGAGAAATTGGAGATGCTGAAGAAACAGTATGATGAGAAGCTGGCACAGAAGGAGGAGCTTCGAAAGAAATCGGAGGAGATGGAGCTGA

AGCTGGAGCGAGCAGGAATGTTGGTGTCTGGGCTAGCTGGTGAAAAGGCACGATGGGAAGAGACTGTGCAG GGCCTGGAGGAGGATCTGGGTTACCTGG

TGGGCGACTGTCTGATTGCAGCTGCGTTCTTGTCCTACATGGGACCCTTTCTGACCAATTACCGGGATGAGATTATCAATCAAATCTGGATCAGGAAG A

TCAGGGAGCTTCAGGTTCCCTGTTCACCTCGCTTTGCCATTGATAACTTCCTGACCAATCCCACCAAAGTCCGGGACTGGAACATCCAGGGGTTGCCCTC

AGATGCCTTCTCCACAGAGAATGGCATCATCGTCACCAGGGGCAACAG GTGGGCCCTCATGATCGATCCTCAGGGCCAAGCCCTCAAGTGGATTAAGAA

CATGGAAGGAAACCAG GGCCTTAAAATCATCGACCTGCAGATGCATGACTACCTTCGAGTTCTAGAACATGCCATCCAGTTTGGATTTCCAGTGCTACT

CCAGAATGTGCAGGAGTATCTGGACCCCACGCTCAACCCAGTGCTCAACAAATCTGTAGCTCGAATTG GTGGTCGGATGCTGATTCGAATTGGTGACAA

GGAGGTGGAATACAATCCCAATTTCCGTTTCTACCTCACCACCAAGCTCTCCAATCCCCACTATAATCCAGAGACTTCGGCTAAGACCACCATTGTCAAC

TTCGCTGTAAAGGAGCAG GGCCTGGAAGCCCAGCTGCTGGGCATTGTGGTTCGGAAGGAGCGACCAGAGCTGGAGGAGCAGAAGGACTCTCTGGTCATC

AACATCGCTGCAGGAAAGAGAAAGCTCAAAGAACTAGAGGATGAGATCCTGCG CTTGTTGAATGAGGCCACAGGCTCTCTGCTTGATGACGTGCAGCTG

GTGAATACCCTCCAGACATCCAAGATAACGGCCACCGAGGTGACCGAGCAACTGGAGACCAGTGAGACCACAGAGATCAACATTGACTTGGCCCGAGAG 

GCTTACCGTCCGTGTGCCCAGCGGGCCTCGGTGCTGTTCTTTGTGCTCAATGACATGGGCCGCATTGACCCCATGTACCAGTTCTCCCTGGACGCCTACA

TCGGCCTCTTTATCCTCAGCATTGACAAGAGCCACCGCAGCAATAAGCTGGAGGACCGCATCGAGTACCTGAATGACTACCACACCTATGCTGTCTACAG

 GTACACCTGCCGAACCCTTTTTGAGCGCCACAAGCTTCTGTTCAGTTTTCACATGTGCGCCAAAATCCTGGAGACGTCCGGCAAGCTCAACATGGATGA

GTACAACTTCTTCCTGCGTGGGGGTGTG GTCCTGGATCGTGAAGGCCAAATGGACAATCCATGTACCAGTTGGCTGGCAGATGCCTACTGGGATAATAT

CACAGAACTGGACAAACTGACCAACTTCCATGGGCTCATGAACTCCTTTGAGCAGTACCCTCGGGACTGGCACCTGTGGTACACCAACTCTTCCCCGGAG

AAGGCCATGCTGCCAG GTGAGTGGGAGAATGCGTGCAATGAGATGCAGCGGATGCTGATCGTCCGCTCCCTGCGTCAGGACCGAGTGGCATTCTGTGTT

ACTTCCTTCATCGTGTCCAACCTTGGCTCTCGATTCATTGAACCGCCTGTGCTAAACATGAAATCG GTGATGGAGGACTCTACCCCGAGATCCCCACTG

GTATTCATCCTGTCCCCCGGTGTAGACCCCACCAGCGCTCTGCTTCAGCTGGCGGAGCACACAGGCATGGCCCACCGCTTCCATGCCCTGTCCCTGGGCC

AGGGCCAGGCCCCCATTGCTGCTCGGCTTCTTCGAGAGGGTGTGAATCAAG GGCACTGGGTGTTCCTGGCAAACTGCCACCTGTCTCTGTCTTGGATGC

CTAATCTGGACAAGTTGGTGGAGCAACTGCAGGTGGAGGACCCTCACCCTTCCTTCCGCCTGTGGCTCAGCTCTAGCCCCCACCCAGACTTCCCAATCTC

CATCCTGCAGGCCAGCATCAAGATGACCACAGAGCCACCAAAG GGTCTAAAGGCCAACATGACACGTCTTTATCAGCTGATGACAGAGGCACAGTTTAC

CCACTGCTCCAAGCCTGCCAAGTATAAGAAGCTGCTCTTTGCCCTCTGCTTCTTCCATTCCATATTACTCGAGCGCAAAAAATTTTTACAGCTTGGCTGG

AATATTATTTATGGCTTCAACGACTCTGACTTTGAG GTGTCAGAGAACCTGCTGAGCCTCTATCTGGATGAGTATGAAGAGACACCCTGGGACGCGCTC

AAATACCTCATCGCTGGTGTCAACTATGGGGGACATGTCACAGATGACTGGGACCGGCGTCTGCTCACCACCTATATCAATGATTATTTCTGTGATCTGA

GCCTAACAACTCCCTTCTACCG GTTGTCTGTACTGGACACTTATTACATCCCAAAGGACGGGAGCTTGGCCTCTTACAAAGAATATATCAGCATGCTGC

CTAGTATGGACCCCCCTGAGGCCTTTGGCCAACACCCCAACGCTGACGTGGCCTCCCAGATCACAGAGGCCCGGACCCTCTTTGAGACCCTGCTTTCCCT

GCAACCCCAGATCACACCCACCAGGGTTGGTGGCCAGAGCCGAGAAGAGAAG GTCCTAGAGTTGGCTGCTGATGTGAAGCAGAAGATCCCCGAGATGAT

CGACTATGAGGGGACCCGAAAGTTGCTGGCTCTTGACCCCTCCCCACTCAATGTGGTCCTCCTGCAGGAGATCCAGAGATATAACAAGTTGATGAAGACC

ATCTT GTTCTCCCTGACAGACTTGGAGAAGGGCATCCAGGGCCTCATCGTCATGTCAACAAGCCTGGAAGAGATCTTCAACTGCATATTTGATGCTCAT

GTCCCTCCACTCTGGGGAAAG GTATATCCCTCACAAAAGCCCTTGGCGTCATGGACCCGGGACCTGGCTGTGCGTGTGGAACAGTTTGAAACATGGGCC

AGTCGAGCCCGCCCTCCGGTGCTCTTTTGGCTGTCTGGCTTCACTTTCCCCACTGGCTTCCTCACTGCGGTACTGCAGTCTGCCGCTCGCCAAAACAAC 

ATCTCAGTGGACAGCCTCTCTTGGGAATTTATAGTTTCCACTGTGGACGACAGCAACCTGGTGTATCCACCCAAG - UNI32991 - GATGGAGTTTG

GGTTCGGGGCCTGTACCTGGAGGGTGCTGGCTGGGACCGAAAGAATTCTTGTTTAGTGGAGGCGGAGCCCATGCAGCTGGTCTGCCTCATGCCCACGATC

CACTTCCGTCCAGCAGAGAGCCGAAAGAAAAGTGCCAAGG - UNI32991 - GCATGTACTCCTGTCCCTGCTATTATTATCCCAACCGGGCAGGCAG

CACAGATCGAGCCTCCTTTGTCATAGGCATCGATCTCCGATCTGGATCCATGACATCTGATCACTGGATTAAGAGGGGCACTGCTCTACTGATGAGCCTG

GACAGCTGATGAGCTCTTCTCTCCTCCTTGAGAGGGTCGGAAGCCCTAGGACCTTGAACTAAAGCTGGATCTCAGGCTTTGACTTTAGCTGAATCTAGCA

TATAGTGACACTCTGACAGTACCTAGTGGCGCTAGCGGAAAAGGTGGAAGACTTGTATTGGCGCTCAGTGCAGTAAAAACCGTGCAAAACCAA
Translation
 - UNI18325 - - UNI31284 - MASKAEKKRKVAGRGGARAGRVVRAPQSTAGPGATEASLLPDGQEPEPESGKEDSV - UNI18325 - - U

NI31284 - VLGLQAFASWRLTPALHGEANTPPTLLHPQPLFHRRLTTLNLILSCSRAGTRDLAL KPFFLSRTMLTGLADATWTGEHDMVLEHFVQDP

AVPALTIFIDPVFGLKLELGMPVQ TQNQIVYFIRQAPVPITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASL

TD DTRYKLEGHTVLYIPAEAVQMDPEVVVKDKELVQRLET TSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIE

SILFLAKSSYLTPFRKLAQQIQ DGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRK VCECQYHFARWE

DGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGILDVKNTSWHEDYNK KFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLAT

RE AIMRTYEKKAVDLYMLFNSELALVNRELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMN CLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKT

FQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDK KTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNR RIIAMLSPDEQ

ALFKERIRFLDKKIHPGLKKLNWALKGASAFFITECRMHASK VQMIVNDFKASTLTIGWKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAAQQKLV

KLHQDVVNIMTNSYEVFKNDGPE IQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRVLVILQNDVRGGGSQ VEFSPTLQTLAS

VVNDIGSHLFATISVFRHLPDILTKRKMNREPIYVLVE ERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDA

DIAR RYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEK KISHPPQTLEELGVSLQLMDTLQHDL

PNLETQIPPIHEQFTILEKYEVPVPDT VLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKG GPFTSTVGHTAA

LDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEK - UNI24175 - ELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLF

RRLTRLAKEYK DRNWEIIETTRSKIEQFKRTMPLISDLRNPALRER RHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIE

V GLQNIAKTWDSTQLDIVPYKDKGHHRLR RGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLE NIFLGED

IRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPG GLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHL

KKCFDNIKLLKIQK VGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVE SWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQ VVITASQ

IQWTADVTKCLMTAKERSDKKILKVMKKKQ VSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEK DVDDC

IIRQTNTQFQYGYEYLGNSGRLVITPLTDR RCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQ SGAW

GCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPG GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNC

K ILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEE VLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGK - U

NI22594 - LRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVR EFPLNPKALSLGELYG

EYDLNTNEWTDGILSSVMRVACAD DEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQ VSLLFEVENLAVASPATVSRCGMVYTDY

VDLGWKPYVQSWLEKRPK TEVEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENG VNPADAENYSFMVEMTFVFSMIWSVCA

SVDEDGRKKIDSYLREIEGSFPNK DTVYEYYVNPKMRTWTSFEEKLPKSWRYPPN NAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTS

IAQSVLQSLPSSQWSVLVVNMSAQ TTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIR

 DMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPT ESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISK

 VFQGMLRANKDFHDTKASITRLWIHECFR RVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFG GDFLKEPKVYEDLVDLTVLKTAM

ETALNEYNLSPSVVPMQLVLFREAIEHI ITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDD DIKRLYRQAGVEL

QTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEE IQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFR RNWIRQYPAL

VNCTTINWFSEWPREALLEVAEKYIIGVDLGTQEN IHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKK KLLGEKRQELLDQANK

LRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQK AVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMR ALES

LNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLG GEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRA

ME LYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLRE VAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQ G

LEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRK IRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNR RWALMID

PQGQALKWIKNMEGNQ GLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIG GGRMLIRIGDKEVEYNPNFRFYLTTKLSNPH

YNPETSAKTTIVNFAVKEQ GLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILR RLLNEATGSLLDDVQLVNTLQTSKITATEVTEQL

ETSETTEINIDLARE AYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYR RYTCRTLFERHKLLFS

FHMCAKILETSGKLNMDEYNFFLRGGV VLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPG GEWENACN

EMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKS VMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLRE

GVNQG GHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPK GLKANMTRLYQLMTEAQFTHCSKPAKYKK

LLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFE VSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYR R

LSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEK VLELAADVKQKIPEMIDYEGTRK

LLALDPSPLNVVLLQEIQRYNKLMKTIL LFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK VYPSQKPLASWTRDLAVRVEQFETWASRARP

PVLFWLSGFTFPTGFLTAVLQSAARQNN ISVDSLSWEFIVSTVDDSNLVYPPK - UNI32991 - DGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVC

LMPTIHFRPAESRKKSAKG - UNI32991 - GMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLDS
Transcript ENSMUST00000035539
Sequence
GTTTTGCCTTCAAGATGGCTAGCAAAGCCGAGAAGAAGCGAAAAGTGGCTGGCCGGGGAGGCGCCCGGGCAGGCCGAGTTGTCCGAGCTCCTCAGTCCAC

TGCAGGCCCAGGAGCTACAGAGGCTTCCCTGCTCCCTGATGGTCAGGAGCCAGAGCCCGAGTCTGGCAAGGAGGACTCTG - UNI18325 - - UNI3

1284 - TGCTGGGATTACAGGCATTTGCCAGCTGGAGATTGACCCCAGCGCTTCATGGAGAGGCTAACACTCCACCAACTCTGCTGCATCCCCAGCCCC

TGTTTCACAGACGTCTTACAACTTTGAATCTTATTCTGTCCTGTTCTAGAGCTGGAACTCGGGATCTTGCTCTG AAGCCCTTCTTCCTCTCACGAACGA

TGTTGACCGGACTGGCAGATGCCACGTGGACGGGGGAGCACGACATGGTTCTGGAGCACTTTGTCCAGGATCCTGCGGTGCCTGCCCTCACCATCTTCAT

TGACCCCGTCTTTGGGTTGAAGCTGGAGCTGGGCATGCCTGTGCAG ACGCAGAATCAGATTGTGTACTTCATTCGACAAGCCCCAGTTCCCATCACCCC

AGAGAACTTCGAGGAGACTGTGCAGTATGGGACGGTGCGGGGTGCCTACATCCCGGCTTTGCTCCGGCTGCTCAGCGGTGTCTACGTCCCCCAGATTTTT

ATGAATAAGTCTTGGCCTGAGAGCATCCGGAATCATTTTGTTTCACACCTGCATAGGTTTTTGGCCTCTCTGACAG ATACTCGCTACAAGCTGGAGGGT

CACACGGTACTGTACATCCCTGCAGAGGCCGTACAGATGGACCCTGAGGTGGTGGTAAAGGACAAAGAGCTGGTACAGCGGCTAGAGA CCTCCATGATC

CACTGGACGAGGCAGATCAAGGAAGTGCTGAGTGCCCAGGAGTCTGTGGAGACCGGAGAGAACTTAGGCCCTTTGGAGGAGATCGAGTTCTGGCACAATC

GCTGCATGGACCTGTCCAGCATCAGCAAGCAGCTGGTGAAGAAGGGTGTGAAACACATCGAGTCCATCCTGTTTCTGGCCAAGTCATCCTACTTGACGCC

CTTCAGGAAGCTGGCCCAGCAGATCCAG GATGGCTCTCGACAAGCTCAGTCCAACCTGACTTTCTTGTCCATCCTGAGGGAACCCTACCAGGAGTTGGC

CTTCATGAAGCCTAAGGACATCTCTGAGAAGCTCCCGAAGCTGATCAGCCTCATCCGAATCATCTGGGTCAACTCCCCCCACTACAACACTCGGGAAAGG

CTGACGGCGCTGTTCCGGAAG GTATGCGAATGTCAGTACCACTTTGCCCGTTGGGAAGACGGCAAGCAAGGTCCCCTTCCATGCTTCTTCGGTGCCCAG

GGGCCACAGATCACACGAAACTTGCTAGAAATCGAGGACATCTTTCATAAAAATCTGCAAACGCTGCGAGCCGTGCGTGGCGGCATCCTGGATGTTAAGA

ACACCTCTTGGCACGAAGACTACAACAA ATTCCGTGGTGGTATCAAGGACCTGGAGGTGATGACCCAGAATCTGATTACCTCGGCCTTTGAGTTGGTCC

GGGACGTAGAGCACGGAGTGCTGCTCTTGGACACTTTCCACAGGCTGGCCACTCGGGAG GCCATCATGCGAACCTATGAGAAAAAGGCTGTCGACCTCT

ACATGCTGTTCAATAGTGAGTTAGCCCTGGTGAACCGGGAGCTGAACAAGAAATGGCCATATCTGGAGCCATACATGACTCAGTACTCTGGACAGGCCCA

CTGGGTGCGGATCCTTCGGCGACGCATAGACAGAGTCATGAAC TGCCTTTCCGGAGCCCACTTCCTGCCCCATATTGGGACTGGCGAGGAGAGCATACA

TACCTATCAGCAGATGGCTCAAGCCATTGATGAAATGGTTCGAAAAACCTTCCAAGAGTGGACAGCGACGCTGGACAAGGACTGCATTCGGCGACTGGAC

ATGTCACTGTTACGAATTAGCCAGGAGAAAGTGGGCATGCTGGATGTCAACTTTGACAA GACACTCCTGATTCTCTTTGCGGAGATTGACTACTGGGAG

CGGCTGCTGTTTGAGACACCGCACTACGTGATGAACGTGGCTGAACGCGCCGAGGACCTGCGCATTCTCCGGGAGAACCTGCTCCTTGTTGCTCGAGACT

ATAACAG GATTATTGCCATGCTGTCCCCAGACGAGCAGGCCCTGTTCAAAGAGCGGATCCGGTTCCTGGATAAGAAGATCCACCCTGGACTGAAGAAGC

TGAATTGGGCCCTGAAGGGGGCCAGTGCCTTCTTCATCACCGAGTGCCGCATGCATGCCAGCAAG GTGCAGATGATTGTGAACGACTTCAAGGCCTCCA

CCCTGACCATCGGCTGGAAGGCCCAGGAGATGTCGGAACTGCTGCTGGTGCACATCACTGGCAAGCAGGTGTACAGGGACCTGGAGTTCGAGGAGGCCCA

GAGAGAGCACCGGATGGCCGCACAGCAAAAGCTGGTGAAGCTGCACCAAGATGTGGTGAACATCATGACCAACTCCTACGAAGTGTTCAAGAACGATGGC

CCCGAG ATTCAGCAGCAGTGGTTGCTCTACACCATACGGCTGGATCACATGATGGAGGACGCCCTGCGCCTGAACGTGAAGTGGTCACTGCTGGAGCTT

TCCAAGGCCATCAACGGGGATGGAAAGACCACTCCAAACCCGCTCTTCAGGGTCCTTGTCATTTTACAGAATGATGTGCGGGGAGGTGGGTCACAG GTG

GAATTCTCCCCGACTCTGCAGACTCTGGCGAGTGTGGTCAATGACATAGGCAGCCACCTCTTTGCCACCATCTCTGTCTTCCGCCACCTCCCCGACATCC

TCACCAAACGCAAGATGAATCGAGAGCCCATTTATGTACTTGTGG AGCGAGACGAGGACATCAGGAAGATCCAGGCCCAGATCAGCAGTGGCATGACTA

ACAATGCGAGCCTGCTGCAGAATTACCTCAAGACCTGGGACATGTACCGGGAGATCTGGGAGATCAACAAGGACTCCTTCATTCGCCGCTACCAGCGCCT

CAACCCCCCTGTCTCCTCTTTTGATGCTGACATTGCCCG CTACACGGAGGTGGCGAACAATGTGCAGAAGGAAGAGACGGTCCTCAACATCCAGTTCGT

GATGCTGGACTGCTCTCACCTCAAGTTCTCGCTGGTGCAGCACTGCAACGAGTGGCAGAACAAGTTCACAACCCTGCTCAAGGAGATGGCAGCTGGGCGC

CTTGCGGACCTGCACTCCTACCTCAAGGACAATGCTGAAAA AATCAGCCACCCTCCCCAGACGCTGGAGGAGCTAGGGGTCAGCCTGCAGCTCATGGAC

ACCCTGCAGCATGACCTACCCAACCTGGAGACTCAGATCCCCCCCATTCACGAGCAGTTTACCATTTTGGAGAAGTATGAGGTGCCAGTTCCGGACACT 

GTCCTGGAGATGCTGGAGAGCCTCAATGGGGAGTGGCTCACCTTCCAACAAATCCTGCTGGATAGCGAGCAGATGCTGAAGAAACACAAGGAGAAGTTCA

AGACAGGCCTTATCCATGCCGCCGATGACTTCAAGAAGAAGGCACACAACCTTCTAGAAGACTTTGAGTTCAAAG GGCCGTTTACCAGCACCGTGGGCC

ACACGGCTGCACTGGATCAGATCGCACAGATGCGCGCCATGCTGATGGCCATGCGGGACGAGGAGAACAACCTCCGCTCCAATCTGGGCATCTTCAAGAT

CGAGCAGCCGGTCTCCAAGGACCTCCAGATCCTGGAGAAG - UNI24175 - GAGCTCGATGCCCTCCAGCAAGTGTGGGAGATCACCCGGGACTGGG

AGGAGAGCTGGAACCAGTGGAAGATGGGCTGCTTCCAGACCCTGCAGACGGAAGCCATGGAGTCCATGGCTCATGGGCTGTTCCGCCGCCTCACGAGACT

AGCCAAAGAGTACAAG GACCGAAACTGGGAAATCATTGAAACGACTCGCTCCAAAATAGAGCAGTTCAAGAGGACCATGCCCCTCATCTCAGACCTGCG

GAATCCAGCCCTCAGAGAGAG GCACTGGGACCAGGTCAAAGAGGAAGTCCAGCGGGAGTTTGATCAGGAGTCAGAGAGCTTCACCTTGGAGCAGATTGT

GAAACTAGGGATGGATCAGCACGTGGAGAAGATTGCAGAGATCTCAGCCTCTGCGACCAAAGAGCTGGCCATAGAAGTG GGATTACAAAATATTGCCAA

GACCTGGGATTCGACTCAGCTAGACATAGTACCCTACAAGGACAAGGGCCATCACCGGCTCAG GGGAACAGAGGAAGTGTTCCAGGCACTGGAAGATAA

TCAGGTGGCCCTGTCAACCATGAAGGCATCTCGATTCGTGAAGGCCTTTGAGAAGGATGTGGACCACTGGGAGCGCTGCCTCTCTCTCATTCTGGAAGTT

ATTGAGATGGTCCTCACTGTGCAGAGACAGTGGATGTACCTAGAG AATATCTTCCTTGGAGAGGACATCCGGAAACAGCTGCCCAATGAGTCAGCCCTA

TTTGACCAGGTCAACAACAACTGGAAAGCCATCATGGACCGAATGAACAAAGACAATAACGCTCTCCGGAGCACCCACTACCCAG GACTCCTGGAGACA

CTGATAGAAATGAACGCAATCCTGGAGGACATTCAGAAGTCCCTGGACATGTACTTAGAGACCAAGCGCCACATATTCCCCCGCTTCTACTTCCTGTCCA

ATGATGACCTGCTGGAGATCCTGGGCCAGTCCCGTAACCCAGAGGCTGTGCAGCCACACCTCAAAAAGTGCTTTGACAACATCAAACTGCTGAAAATTCA

AAAG GTCGGGGGCTCCAGCAGCAAGTGGGAGGCAGTGGGAATGTTCTCAGGTGACGGTGAATACATTGACTTCCTCCACCCAGTACTTCTAGAAGGACC

AGTGGAG TCGTGGCTTGGTGATGTGGAGCGGGCCATGAGGATGACCCTTCGGGATTTGCTTCGAAACTGCCGCGTGGCCCTCAAGAAGTTCCTCAACAA

GAGAGACAAATGGGTGAAAGACTGGGCTGGCCAG GTGGTGATCACTGCTAGTCAGATCCAGTGGACAGCTGATGTCACCAAGTGCCTGATGACAGCCAA

AGAGCGATCAGACAAGAAAATCCTCAAG GTGTCAATACTAAATAAGTATTCAGAGGCCATCAGGGGGAACTTGACCAAGATCATGAGACTTAAGATTGT

GGCTCTGGTGACGATAGAAATTCACGCCCGCGACGTGCTGGAAAAGCTCTACAAGAGCGGCCTCATGGATGTCAGTTCCTTTGACTGGCTCAGCCAGCTG

CGCTTCTACTGGGAGAAG GATGTGGATGACTGTATAATCCGCCAGACCAACACACAATTCCAATATGGTTATGAGTACTTGGGGAACTCTGGTCGGCTG

GTCATCACTCCCCTGACAGACAG ATGTTACATGACATTGACCACGGCACTGCACCTTCATCGCGGGGGCTCCCCCAAAGGCCCAGCAGGTACTGGAAAG

ACAGAAACTGTCAAAGACCTGGGCAAGGCGCTGGGTATATATGTCATCGTGGTCAACTGCTCCGAGGGCTTGGACTATAAGTCCATGGGAAGAATGTACT

CAGGACTGGCACAG AGTGGAGCCTGGGGCTGCTTTGACGAGTTTAACCGCATCAACATTGAGGTGTTGTCCGTGGTGGCCCAGCAGATCCTGTCCATCC

TATCTGCCTTGACTGCCAACCTCACACGTTTCTATTTTGAGGGCTTTGAAATAAATCTGGTGTGGTCTTGTGGGATCTTCATCACCATGAATCCTG GCT

ATGCCGGCCGCACAGAGCTTCCAGAGAACCTAAAGTCCATGTTCCGCCCAATTGCCATGGTGGTGCCTGATTCTACGCTTATTGCGGAAATCATTCTCTT

TGGGGAGGGCTTTGGCAACTGCAAG ATCCTGGCCAAGAAGGTGTACACACTGTACTCACTGGCTGTGCAGCAGCTCTCCAGACAGGACCACTACGACTT

CGGCCTGCGCGCCCTCACTTCCCTGTTGCGCTATGCTGGCAAGAAGCGTCGCCTACAGCCAGATCTGTCTGATGAAGAG GTTCTGCTGCTCTCCATGAG

AGACATGAACATCGCCAAGCTGACGTCAGTGGATGTCCCATTGTTCAATGCTATTGTGCAGGACCTCTTCCCCAACATCGAGCTCCCGGTCATTGACTAT

GGCAAG - UNI22594 - CTACGGGACACCATCGAGCAGGAGATCCGAGAAATGGGCCTGCAGATCACACCCTTTACCCTCACCAAGGTTTTACAGTT

GTACGAAACCAAGAACTCTCGCCACTCCACCATGATTGTGGGTGGCACCGGCAGCAGCAAGACCACCTCCTGGAAAATTCTGCAGGCCTCTCTGACGTCC

CTGTGCCGTGCTGGAGAACCCAACTACAACATCGTTAGA GAGTTCCCTTTGAACCCAAAGGCACTGTCCTTAGGGGAGCTGTATGGCGAGTATGACCTC

AACACCAACGAATGGACCGATGGCATCCTGTCTAGTGTCATGCGGGTTGCCTGTGCAG ATGAGAAGCCAGACGAGAAATGGATCCTTTTTGATGGCCCC

GTGGACACGCTGTGGATCGAGAGCATGAACTCTGTCATGGACGATAACAAAGTGCTGACCCTTATCAATGGCGAGCGCATTGCGATGCCCGAGCAG GTG

TCTCTCTTGTTTGAAGTGGAGAACTTGGCTGTGGCCTCTCCAGCCACTGTGTCCCGCTGTGGGATGGTCTACACTGACTATGTGGACCTGGGCTGGAAGC

CTTATGTTCAGTCATGGCTGGAAAAGAGGCCAAAG ACAGAAGTAGAGCCGCTTCAACGCATGTTTGAAAAGTTCATCAACAAGATACTGAGCTTCAAAA

AGGATAACTGTAATGAGCTGGTACCTGTCCCCGAGTACAGTGGGATCATCTCCCTCTGTAAGCTCTACACAGTCCTGGCCACACCTGAGAATGGG GTGA

ACCCAGCCGATGCCGAGAACTACTCCTTTATGGTGGAGATGACCTTTGTGTTCAGCATGATCTGGTCTGTGTGTGCCTCTGTGGACGAGGACGGACGCAA

GAAGATTGACAGCTACCTTCGAGAAATCGAGGGCTCCTTTCCCAATAAG GACACAGTGTATGAATACTACGTGAACCCCAAGATGCGGACTTGGACGTC

ATTTGAGGAGAAGCTCCCCAAGAGCTGGCGTTATCCTCCCAA CGCCCCTTTCTATAAGATCATGGTACCTACTGTTGATACTGTGCGGTATAACTACTT

AGTGAGCACCCTGGTGGCCAACCAGAATCCTGTCTTACTGGTGGGTCCTGTGGGAACTGGAAAGACCTCCATAGCCCAGAGTGTTCTCCAGTCCTTGCCC

TCCAGCCAGTGGTCAGTGCTCGTCGTCAACATGTCCGCACAG ACCACGTCAAACAATGTGCAGAGCATCATTGAGAGCAGAGTAGAGAAGCGGACCAAG

GGTGTGTATGTGCCATTCGGGGGCAAAAGCATGATTACTTTTATGGATGACCTAAACATGCCTGCCAAGGACATGTTTGGGTCCCAGCCGCCCCTGGAGC

TGATTCGCCTCTGGATTGACTACGGCTTCTGGTACGATCGTGTGAAGCAGAGCATCAAGCACATCCGA GACATGTTCCTGATGGCTGCCATGGGCCCTC

CTGGGGGTGGACGGACTGTTATCTCCCCAAGGCTGCAGAGTCGCTTCAACATTATCAACATGACCTTCCCCACG GAATCCCAGATCATCCGCATATTTG

GCACCATGATCAACCAGAAGCTCCAGGACTTTGAAGAAGAGGTGAAGCCCATTGGGAATGTGGTAACAGAGGCCACCCTGGACGTTTACAATACGGTGGT

ACAGCGCTTCCTGCCCACCCCGGCGAAGATCCATTACCTCTTCAACCTCCGGGACATCTCCAAG GTCTTCCAGGGCATGCTTAGAGCCAACAAGGACTT

TCATGATACCAAAGCCAGCATCACAAGACTCTGGATTCATGAGTGTTTCAG AGTCTTCTCTGACAGACTGGTCGATACAGCAGACATGGAAGCCTTTAT

GGGCATCTTAAGTGACAAACTCGGTACCTTCTTTGACCTCACGTTTCATCATCTCTGTCCCAACAAACGCCCTCCCATCTTTG GGGACTTCCTGAAGGA

GCCCAAGGTCTATGAAGACCTGGTAGACCTGACAGTATTGAAGACAGCCATGGAGACGGCCCTGAATGAGTACAATCTGTCTCCTTCGGTTGTGCCAATG

CAGCTGGTGCTCTTCCGAGAGGCCATTGAACACA TCACTCGGATCGTGCGTGTGATCGGACAGCCCCGAGGCAACATGTTGCTGGTGGGGATCGGGGGC

AGCGGGAGGCAGAGTCTGGCCCGCTTGGCGTCTTCCATCTGCGATTATAACACGTTCCAGATCGAGGTCACCAAGCACTACCGCAAACAGGAGTTCCGAG

ACG ATATCAAGCGCTTGTATCGACAGGCAGGGGTAGAACTCCAGACCACGTCTTTCCTTTTCGTGGACACCCAGATAGCTGACGAATCCTTCCTGGAAG

ACATCAACAACATCCTTAGCTCGGGCGAAGTCCCCAATCTCTACAAGTCTGACGAATTTGAAGAG ATCCAGAACCATATCATAGACCAGGCCCGGGCAG

AACAGATACCAGAATCCTCGGACAGCCTCTTTGCATACCTCATCGAGCGCGTGCGGAACAACCTGCACATTGTGCTCTGTCTAAGTCCCGTGGGAGACCC

CTTCAG GAATTGGATTCGCCAGTACCCAGCCTTAGTAAACTGTACAACCATCAACTGGTTCTCAGAGTGGCCCCGAGAGGCCTTGCTAGAGGTGGCTGA

GAAGTACATTATAGGAGTGGACTTGGGGACACAGGAGAAT ATCCACAGGAAAGTGGCCCAAATCTTTGTCACCATGCACTGGTCAGTGGCTCAGTATTC

CCAGAAGATGCTGTTGGAACTGCGGAGATACAACTATGTCACACCCACAAACTACCTGGAGCTCGTGTCTGGATATAAAAA GCTTCTGGGAGAAAAGCG

GCAGGAGCTGCTGGACCAAGCCAATAAGCTTCGAACTGGATTGTTTAAGATTGACGAAACTAGGGAGAAAGTCGAAGTGATGTCCTTGGAGCTGGAGGAC

GCCAAGAAAAAAGTGGCAGAGTTCCAGAAGCAGTGCGAAGAATACCTGGTCATCATTGTGCAGCAGAAGCGGGAAGCAGATGAGCAGCAGAAG GCCGTC

ACTGCCAATAGTGAGAAGATCGCTATTGAGGAGGTCAAGTGCCAGGCGCTGGCCGACAATGCCCAGAAGGATCTAGAGGAAGCATTGCCCGCCCTTGAAG

AAGCCATGCGG GCCCTAGAGTCTCTGAACAAGAAGGACATAGGTGAGATCAAGTCCTACGGACGACCCCCTGCGCAGGTGGAAATTGTAATGCAGGCAG

TCATGATTCTTCGAGGCAATGAGCCCACGTGGGCAGAAGCAAAGCGACAGTTAG GGGAGCAGAACTTCATCAAGTCATTGATCAACTTTGATAAAGACA

ACATCTCAGATAAGGTATTGAAGAAGATCGGGGCCTACTGCGCCCAGCCCGACTTCCAGCCTGATATCATTGGCAGAGTCTCCCTGGCTGCTAAGTCCCT

CTGCATGTGGGTGCGGGCCATGGAG TTGTACGGGCGTCTGTATCGAGTGGTAGAGCCTAAGCGGATCCGAATGAACGCCGCCATGGCCCAGCTTCAGGA

GAAGCAAGCAGCCCTAGCTGAAGCCCAGGAAAAGCTGCGAGAG GTGGCAGAGAAATTGGAGATGCTGAAGAAACAGTATGATGAGAAGCTGGCACAGAA

GGAGGAGCTTCGAAAGAAATCGGAGGAGATGGAGCTGAAGCTGGAGCGAGCAGGAATGTTGGTGTCTGGGCTAGCTGGTGAAAAGGCACGATGGGAAGAG

ACTGTGCAG GGCCTGGAGGAGGATCTGGGTTACCTGGTGGGCGACTGTCTGATTGCAGCTGCGTTCTTGTCCTACATGGGACCCTTTCTGACCAATTAC

CGGGATGAGATTATCAATCAAATCTGGATCAGGAAG ATCAGGGAGCTTCAGGTTCCCTGTTCACCTCGCTTTGCCATTGATAACTTCCTGACCAATCCC

ACCAAAGTCCGGGACTGGAACATCCAGGGGTTGCCCTCAGATGCCTTCTCCACAGAGAATGGCATCATCGTCACCAGGGGCAACAG GTGGGCCCTCATG

ATCGATCCTCAGGGCCAAGCCCTCAAGTGGATTAAGAACATGGAAGGAAACCAG GGCCTTAAAATCATCGACCTGCAGATGCATGACTACCTTCGAGTT

CTAGAACATGCCATCCAGTTTGGATTTCCAGTGCTACTCCAGAATGTGCAGGAGTATCTGGACCCCACGCTCAACCCAGTGCTCAACAAATCTGTAGCTC

GAATTG GTGGTCGGATGCTGATTCGAATTGGTGACAAGGAGGTGGAATACAATCCCAATTTCCGTTTCTACCTCACCACCAAGCTCTCCAATCCCCACT

ATAATCCAGAGACTTCGGCTAAGACCACCATTGTCAACTTCGCTGTAAAGGAGCAG GGCCTGGAAGCCCAGCTGCTGGGCATTGTGGTTCGGAAGGAGC

GACCAGAGCTGGAGGAGCAGAAGGACTCTCTGGTCATCAACATCGCTGCAGGAAAGAGAAAGCTCAAAGAACTAGAGGATGAGATCCTGCG CTTGTTGA

ATGAGGCCACAGGCTCTCTGCTTGATGACGTGCAGCTGGTGAATACCCTCCAGACATCCAAGATAACGGCCACCGAGGTGACCGAGCAACTGGAGACCAG

TGAGACCACAGAGATCAACATTGACTTGGCCCGAGAG GCTTACCGTCCGTGTGCCCAGCGGGCCTCGGTGCTGTTCTTTGTGCTCAATGACATGGGCCG

CATTGACCCCATGTACCAGTTCTCCCTGGACGCCTACATCGGCCTCTTTATCCTCAGCATTGACAAGAGCCACCGCAGCAATAAGCTGGAGGACCGCATC

GAGTACCTGAATGACTACCACACCTATGCTGTCTACAG GTACACCTGCCGAACCCTTTTTGAGCGCCACAAGCTTCTGTTCAGTTTTCACATGTGCGCC

AAAATCCTGGAGACGTCCGGCAAGCTCAACATGGATGAGTACAACTTCTTCCTGCGTGGGGGTGTG GTCCTGGATCGTGAAGGCCAAATGGACAATCCA

TGTACCAGTTGGCTGGCAGATGCCTACTGGGATAATATCACAGAACTGGACAAACTGACCAACTTCCATGGGCTCATGAACTCCTTTGAGCAGTACCCTC

GGGACTGGCACCTGTGGTACACCAACTCTTCCCCGGAGAAGGCCATGCTGCCAG GTGAGTGGGAGAATGCGTGCAATGAGATGCAGCGGATGCTGATCG

TCCGCTCCCTGCGTCAGGACCGAGTGGCATTCTGTGTTACTTCCTTCATCGTGTCCAACCTTGGCTCTCGATTCATTGAACCGCCTGTGCTAAACATGAA

ATCG GTGATGGAGGACTCTACCCCGAGATCCCCACTGGTATTCATCCTGTCCCCCGGTGTAGACCCCACCAGCGCTCTGCTTCAGCTGGCGGAGCACAC

AGGCATGGCCCACCGCTTCCATGCCCTGTCCCTGGGCCAGGGCCAGGCCCCCATTGCTGCTCGGCTTCTTCGAGAGGGTGTGAATCAAG GGCACTGGGT

GTTCCTGGCAAACTGCCACCTGTCTCTGTCTTGGATGCCTAATCTGGACAAGTTGGTGGAGCAACTGCAGGTGGAGGACCCTCACCCTTCCTTCCGCCTG

TGGCTCAGCTCTAGCCCCCACCCAGACTTCCCAATCTCCATCCTGCAGGCCAGCATCAAGATGACCACAGAGCCACCAAAG GGTCTAAAGGCCAACATG

ACACGTCTTTATCAGCTGATGACAGAGGCACAGTTTACCCACTGCTCCAAGCCTGCCAAGTATAAGAAGCTGCTCTTTGCCCTCTGCTTCTTCCATTCCA

TATTACTCGAGCGCAAAAAATTTTTACAGCTTGGCTGGAATATTATTTATGGCTTCAACGACTCTGACTTTGAG GTGTCAGAGAACCTGCTGAGCCTCT

ATCTGGATGAGTATGAAGAGACACCCTGGGACGCGCTCAAATACCTCATCGCTGGTGTCAACTATGGGGGACATGTCACAGATGACTGGGACCGGCGTCT

GCTCACCACCTATATCAATGATTATTTCTGTGATCTGAGCCTAACAACTCCCTTCTACCG GTTGTCTGTACTGGACACTTATTACATCCCAAAGGACGG

GAGCTTGGCCTCTTACAAAGAATATATCAGCATGCTGCCTAGTATGGACCCCCCTGAGGCCTTTGGCCAACACCCCAACGCTGACGTGGCCTCCCAGATC

ACAGAGGCCCGGACCCTCTTTGAGACCCTGCTTTCCCTGCAACCCCAGATCACACCCACCAGGGTTGGTGGCCAGAGCCGAGAAGAGAAG GTCCTAGAG

TTGGCTGCTGATGTGAAGCAGAAGATCCCCGAGATGATCGACTATGAGGGGACCCGAAAGTTGCTGGCTCTTGACCCCTCCCCACTCAATGTGGTCCTCC

TGCAGGAGATCCAGAGATATAACAAGTTGATGAAGACCATCTT GTTCTCCCTGACAGACTTGGAGAAGGGCATCCAGGGCCTCATCGTCATGTCAACAA

GCCTGGAAGAGATCTTCAACTGCATATTTGATGCTCATGTCCCTCCACTCTGGGGAAAG GTATATCCCTCACAAAAGCCCTTGGCGTCATGGACCCGGG

ACCTGGCTGTGCGTGTGGAACAGTTTGAAACATGGGCCAGTCGAGCCCGCCCTCCGGTGCTCTTTTGGCTGTCTGGCTTCACTTTCCCCACTGGCTTCCT

CACTGCGGTACTGCAGTCTGCCGCTCGCCAAAACAAC ATCTCAGTGGACAGCCTCTCTTGGGAATTTATAGTTTCCACTGTGGACGACAGCAACCTGGT

GTATCCACCCAAG - UNI32991 - GATGGAGTTTGGGTTCGGGGCCTGTACCTGGAGGGTGCTGGCTGGGACCGAAAGAATTCTTGTTTAGTGGAGG

CGGAGCCCATGCAGCTGGTCTGCCTCATGCCCACGATCCACTTCCGTCCAGCAGAGAGCCGAAAGAAAAGTGCCAAGG - UNI32991 - GCATGTAC

TCCTGTCCCTGCTATTATTATCCCAACCGGGCAGGCAGCACAGATCGAGCCTCCTTTGTCATAGGCATCGATCTCCGATCTGGATCCATGACATCTGATC

ACTGGATTAAGAGGGGCACTGCTCTACTGATGAGCCTGGACAGCTGATGAGCTCTTCTCTCCTCCTTGAGAGGGTCGGAAGCCCTAGGACCTTGAACTAA

AGCTGGATCTCAGGCTTTGACTTTAGCTGAATCTAGCATATAGTGACACTCTGACAGTACCTAGTGGCGCTAGCGGAAAAGGTGGAAGACTTGTATTGGC

GCTCAGTGCAGTAAAAACCGTGCAAAACCAA
Translation
MASKAEKKRKVAGRGGARAGRVVRAPQSTAGPGATEASLLPDGQEPEPESGKEDSV - UNI18325 - - UNI31284 - VLGLQAFASWRLTPALH

GEANTPPTLLHPQPLFHRRLTTLNLILSCSRAGTRDLAL KPFFLSRTMLTGLADATWTGEHDMVLEHFVQDPAVPALTIFIDPVFGLKLELGMPVQ TQ

NQIVYFIRQAPVPITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKSWPESIRNHFVSHLHRFLASLTD DTRYKLEGHTVLYIPAEAVQMDPE

VVVKDKELVQRLET TSMIHWTRQIKEVLSAQESVETGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQ DGSR

QAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRK VCECQYHFARWEDGKQGPLPCFFGAQGPQITRNLLEIED

IFHKNLQTLRAVRGGILDVKNTSWHEDYNK KFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLATRE AIMRTYEKKAVDLYMLFNSELALV

NRELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMN CLSGAHFLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEK

VGMLDVNFDK KTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNR RIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKG

ASAFFITECRMHASK VQMIVNDFKASTLTIGWKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAAQQKLVKLHQDVVNIMTNSYEVFKNDGPE IQQ

QWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPNPLFRVLVILQNDVRGGGSQ VEFSPTLQTLASVVNDIGSHLFATISVFRHLPDILTKRK

MNREPIYVLVE ERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIAR RYTEVANNVQKEETVLNIQFVM

LDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEK KISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDT

 VLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKG GPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGI

FKIEQPVSKDLQILEK - UNI24175 - ELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYK DRNWEIIETTRSKIE

QFKRTMPLISDLRNPALRER RHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEV GLQNIAKTWDSTQLDIVPYKDKGHH

RLR RGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLE NIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMN

KDNNALRSTHYPG GLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQK VGGSSSKWEAVG

MFSGDGEYIDFLHPVLLEGPVE SWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQ VVITASQIQWTADVTKCLMTAKERSDKKILK VS

ILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEK DVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDR RC

YMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQ SGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLT

RFYFEGFEINLVWSCGIFITMNPG GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCK ILAKKVYTLYSLAVQQLSRQDHYDFGLRALT

SLLRYAGKKRRLQPDLSDEE VLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGK - UNI22594 - LRDTIEQEIREMGLQITPFTLTK

VLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVR EFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACAD DEKPDEKW

ILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQ VSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPK TEVEPLQRMFEKFI

NKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENG VNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREIEGSFPNK DTVYEYYV

NPKMRTWTSFEEKLPKSWRYPPN NAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQ TTSNNVQS

IIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIR DMFLMAAMGPPGGGRTVISPRLQSRFNIINMT

FPT ESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISK VFQGMLRANKDFHDTKASITRLWIHECFR RV

FSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFG GDFLKEPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHI ITRI

VRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDD DIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNL

YKSDEFEE IQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFR RNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQ

EN IHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKK KLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQ

KQCEEYLVIIVQQKREADEQQK AVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMR ALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNE

PTWAEAKRQLG GEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAME LYGRLYRVVEPKRIRMNAAMAQLQEKQAAL

AEAQEKLRE VAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQ GLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEI

INQIWIRK IRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNR RWALMIDPQGQALKWIKNMEGNQ GLKIIDLQMHDYLRVL

EHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIG GGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQ GLEAQLLGIVVRK

ERPELEEQKDSLVINIAAGKRKLKELEDEILR RLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLARE AYRPCAQRASVLFFVLN

DMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYR RYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGV VLDRE

GQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPG GEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFI

EPPVLNMKS VMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQG GHWVFLANCHLSLSWMPNLDKLVEQLQ

VEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPK GLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSD

FE VSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYR RLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEA

FGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEK VLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTIL LFSL

TDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK VYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNN ISVD

SLSWEFIVSTVDDSNLVYPPK - UNI32991 - DGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKG - UNI32991 - 

GMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLDS

For any suggestions or comments, please send an email to unitrap@crg.es