Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005320 (Fgfr4)
Chromosomal location
Chr 13: 55254001 - 55270094 (+)
Description
fibroblast growth factor receptor 4 Gene [Source:MGI Symbol;Acc:MGI:95525]
RefSeq_dna
NM_008011 
RefSeq_peptide
NP_032037.2 
UniGene
Mm.413530 Mm.276715 
MGI
MGI:95525 
Uniprot/SWISSPROT
Q03142 
Uniprot/SPTREMBL
Q9ESV4 
Human Ortholog
ENSG00000160867 (FGFR4)
Omim not available
UniTrap UNI31646
Vector Insertion
Chr 13: 55267648 - 55268218
Public Clones IST11206H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099491
Sequence
CCGGCCCTAGTCTCCTGTGCCTACCAGGTGGCCCGAGGCATGCAGTATCTGGAGTCTCGGAAG - UNI31646 - TGCATCCACCGGGACCTGGCTGC

CCGAAATGTGCTGGTGACCGAGGATGATGTGATGAAGATCGCTGACTTTGGGCTGGCACGTGGTGTCCACCACATTGACTACTATAAGAAAACCAGCAAC

 GGCCGCCTGCCAGTCAAATGGATGGCTCCAGAGGCATTGTTCGACCGCGTGTACACACACCAGAGTGACGT GTGGTCTTTCGGGATCCTGCTGTGGGA

AATCTTCACCCTCGGGGGCTCCCCATACCCTGGCATTCCGGTGGAGGAGCTCTTCTCACTGCTGCGAGAGGGGCACAGGATGGAGCGGCCCCCAAACTGC

CCCTCAGAGCT GTATGGGCTAATGAGGGAGTGCTGGCACGCAGCCCCATCTCAGAGGCCTACTTTTAAGCAGCTGGTGGAAGCTCTGGACAAGGTCCTG

CTGGCTGTCTCTGAAGAG GCTGGAAGCTGA
Translation
 - UNI31646 -   MERPPNCPSEL LYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE AGS
Transcript ENSMUST00000067171
Sequence
CCGGAACGACTGAGACTGGGCGATCCAGTCCCAACGGGGAGCTCCCGCACTAGGGTACCGGGCTGACATTTGCCGGGTCTCGGACCACGCCTCTCAGATC

AGAAGTGGTCCAGGAGGGGCGGAGTCCGAGGTGGGCGGGGCAGGAGGGGGCAGCCCCCCGCCACGCTGCAGTTGCAGGGACATTCCTGGCTCTTCGGCCC

GGGGCGGAGGAGCTCCGGGCGGGTGAGTGTGCCAGCCCTGCCGGGATCGTGACCCGCGCGCGCGGGAGCCGGGCGGCGGAGGAGCCAG GAAGGTGGTCA

GTGGGAAGTCTGGCCCTGATCCTGAGATCAGCTGGAAGGAAATGTGGCTGCTCTTGGCCCTGTTGAGCATCTTTCAGGGGACACCAGCTTTGTCCCTTGA

GGCCTCTGAGGAAATGGAGCAGG AGCCCTGCCTAGCCCCAATCCTGGAGCAGCAAGAGCAGGTGTTGACGGTGGCCCTGGGGCAGCCTGTGAGGCTGTG

CTGTGGGCGCACCGAGCGTGGTCGTCACTGGTACAAAGAGGGCAGCCGCCTAGCATCTGCTGGGCGAGTACGGGGTTGGAGAGGCCGCCTGGAGATCGCC

AGCTTCCTTCCTGAGGATGCTGGCCGATACCTCTGCCTGGCCCGTGGCTCCATGACCGTCGTACACAATCTTACGTTGCTTATGGATG ACTCCTTAACC

TCCATCAGTAATGATGAAGACCCCAAGACACTCAGCAGCTCCTCGAGTGGTCATGTCTACCCACAGCAAG CACCCTACTGGACACACCCCCAACGCATG

GAGAAGAAACTGCATGCAGTGCCTGCCGGGAATACTGTCAAATTCCGCTGTCCAGCTGCAGGGAACCCCATGCCTACCATCCACTGGCTCAAGGATGGAC

AGGCCTTCCACGGGGAGAATCGTATTGGAGGCATTCGG CTGCGCCACCAACACTGGAGCCTGGTGATGGAAAGTGTGGTACCCTCGGACCGTGGCACAT

ACACATGCCTTGTGGAGAACTCTCTGGGTAGCATTCGCTACAGCTATCTCCTGGATGTGCTGG AGCGGTCCCCGCACCGGCCCATCCTGCAGGCGGGGC

TCCCAGCCAACACCACAGCTGTGGTTGGCAGCGATGTGGAGCTACTCTGCAAGGTGTACAGCGACGCCCAGCCCCACATACAGTGGCTGAAACACGTCGT

CATCAACGGCAGCAGCTTCGGCGCCGACGGTTTCCCCTACGTACAAGTCCTGAAG ACAACAGACATCAATAGCTCGGAGGTAGAGGTCTTGTATCTGAG

GAACGTGTCCGCTGAGGATGCAGGAGAGTATACCTGTCTGGCGGGCAACTCCATCGGCCTTTCCTACCAGTCAGCGTGGCTCACGGTGCTGCCAG AGGA

AGACCTCACGTGGACAACAGCAACCCCTGAGGCCAGATACACAGATATCATCCTGTATGTATCAGGCTCACTGGTTCTGCTTGTGCTCCTGCTGCTGGCC

GGGGTGTATCATCGGCAAGTCATCCGTGGCCACTACTCTCGCCAGCCTGTCACTATACAAAAGCTGTCCCGTTTCCCTTTGGCCCGACAG TTCTCTTTG

GAGTCGAGGTCCTCTGGCAAGTCAAGTTTGTCCCTGGTGCGAGGTGTCCGTCTCTCCTCCAGCGGCCCGCCCTTGCTCACGGGCCTTGTGAATCTAGACC

TGCCTCTCGATCCGCTTTGGGAATTCCCCCGGGACAG GTTGGTGCTCGGAAAGCCCCTGGGTGAGGGCTGCTTTGGGCAAGTGGTTCGTGCAGAGGCCT

TTGGTATGGATCCCTCCCGGCCCGACCAAACCAGCACCGTGGCTGTGAAGATGCTGAAAG ACAATGCCTCCGACAAGGATTTGGCAGACCTGGTCTCCG

AGATGGAGGTGATGAAGCTAATCGGAAGACACAAGAACATCATCAACCTGCTGGGTGTCTGCACTCAGGAAG GGCCCCTGTACGTGATTGTGGAATGTG

CCGCCAAGGGAAACCTTCGGGAATTCCTCCGTGCCCGGCGCCCCCCAGGCCCTGATCTCAGCCCTGATGGACCTCGGAGCAGCGAAGGACCACTCTCCTT

CCCGGCCCTAGTCTCCTGTGCCTACCAGGTGGCCCGAGGCATGCAGTATCTGGAGTCTCGGAAG - UNI31646 - TGCATCCACCGGGACCTGGCTG

CCCGAAATGTGCTGGTGACCGAGGATGATGTGATGAAGATCGCTGACTTTGGGCTGGCACGTGGTGTCCACCACATTGACTACTATAAGAAAACCAGCAA

C GGCCGCCTGCCAGTCAAATGGATGGCTCCAGAGGCATTGTTCGACCGCGTGTACACACACCAGAGTGACGT GTATGGGCTAATGAGGGAGTGCTGGC

ACGCAGCCCCATCTCAGAGGCCTACTTTTAAGCAGCTGGTGGAAGCTCTGGACAAGGTCCTGCTGGCTGTCTCTGAAGAG TACCTTGACCTCCGCCTGA

CCTTTGGACCCTTTTCTCCCTCCAATGGGGATGCCAGCAGCACCTGCTCCTCCAGTGACTCGGTTTTCAGCCACGACCCTTTGCCCCTCGAGCCAAGCCC

CTTCCCTTTCTCTGACTCGCAGACGACATGAGCCGGGGAGCAGCAATGTTGTATGGGCTACGCGGCCCATGGCCGTGGGTCTCCTCGCTGAGCTGCAACC

TGATGCATCGACATTTAATGTTGGCAGTGTCAGGCCTCTGACTTGAGACTACTGCTGTCGCAGATCCTCTCTCTGGCCCTGTTTTGGGGAGGGCCATTCT

TGGTCCTAAGGTTCATAGTTGAGGCCTTCTGTTCCAGCCTTATGCTCCCATCTCAGAGTTCAACTCTCATCTCAAGATCATGGCCTTGCCCTTGGACTCA

TCCTCAGAGAAGTTAAGCATTAAGGCCTTGGCACGCAGCCTCCGTCTCCGGGGCTCTCCGGGACTAGCTGCAAAACTTATGCTCTAAACATTTCTAGTTC

CCCCAAACAACCTAGAGGCCTTGGGACTTCACATCCCCCAGCACACAAGCCTCACCACCCCCTGCCATCCCCCCTCCATTGCTTGTTCCAGCATCTTGGT

GAAAGGGGCATCAGCTCTGGTGTCCCTGAGAGACGAGAAGCCTGTGGGAACGACAGAAGAACATGGCATTTTTATAAATTATTTTTTTG
Translation
 MWLLLALLSIFQGTPALSLEASEEMEQE EPCLAPILEQQEQVLTVALGQPVRLCCGRTERGRHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYL

CLARGSMTVVHNLTLLMDD DSLTSISNDEDPKTLSSSSSGHVYPQQA APYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENR

IGGIR LRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLE ERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSS

FGADGFPYVQVLK TTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPE EEDLTWTTATPEARYTDIILYVSGSLVLLVLLLLAGVY

HRQVIRGHYSRQPVTIQKLSRFPLARQ FSLESRSSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDR RLVLGKPLGEGCFGQVVRAEAF

GMDPSRPDQTSTVAVKMLKD DNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEG GPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGP

LSFPALVSCAYQVARGMQYLESRK - UNI31646 - CIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSN GRLPVKWMAPEALFDRVYTH

QSDV VYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE YLDLRLTFGPFSPSNGDASSTCSSSDSVFSHDPLPLEPSPFPFSDSQTT
Transcript ENSMUST00000005452
Sequence
CCGGAACGACTGAGACTGGGCGATCCAGTCCCAACGGGGAGCTCCCGCACTAGGGTACCGGGCTGACATTTGCCGGGTCTCGGACCACGCCTCTCAGATC

AGAAGTGGTCCAGGAGGGGCGGAGTCCGAGGTGGGCGGGGCAGGAGGGGGCAGCCCCCCGCCACGCTGCAGTTGCAGGGACATTCCTGGCTCTTCGGCCC

GGGGCGGAGGAGCTCCGGGCGGGTGAGTGTGCCAGCCCTGCCGGGATCGTGACCCGCGCGCGCGGGAGCCGGGCGGCGGAGGAGCCAG GAAGGTGGTCA

GTGGGAAGTCTGGCCCTGATCCTGAGATCAGCTGGAAGGAAATGTGGCTGCTCTTGGCCCTGTTGAGCATCTTTCAGGGGACACCAGCTTTGTCCCTTGA

GGCCTCTGAGGAAATGGAGCAGG AGCCCTGCCTAGCCCCAATCCTGGAGCAGCAAGAGCAGGTGTTGACGGTGGCCCTGGGGCAGCCTGTGAGGCTGTG

CTGTGGGCGCACCGAGCGTGGTCGTCACTGGTACAAAGAGGGCAGCCGCCTAGCATCTGCTGGGCGAGTACGGGGTTGGAGAGGCCGCCTGGAGATCGCC

AGCTTCCTTCCTGAGGATGCTGGCCGATACCTCTGCCTGGCCCGTGGCTCCATGACCGTCGTACACAATCTTACGTTGCTTATGGATG ACTCCTTAACC

TCCATCAGTAATGATGAAGACCCCAAGACACTCAGCAGCTCCTCGAGTGGTCATGTCTACCCACAGCAAG CACCCTACTGGACACACCCCCAACGCATG

GAGAAGAAACTGCATGCAGTGCCTGCCGGGAATACTGTCAAATTCCGCTGTCCAGCTGCAGGGAACCCCATGCCTACCATCCACTGGCTCAAGGATGGAC

AGGCCTTCCACGGGGAGAATCGTATTGGAGGCATTCGG CTGCGCCACCAACACTGGAGCCTGGTGATGGAAAGTGTGGTACCCTCGGACCGTGGCACAT

ACACATGCCTTGTGGAGAACTCTCTGGGTAGCATTCGCTACAGCTATCTCCTGGATGTGCTGG AGCGGTCCCCGCACCGGCCCATCCTGCAGGCGGGGC

TCCCAGCCAACACCACAGCTGTGGTTGGCAGCGATGTGGAGCTACTCTGCAAGGTGTACAGCGACGCCCAGCCCCACATACAGTGGCTGAAACACGTCGT

CATCAACGGCAGCAGCTTCGGCGCCGACGGTTTCCCCTACGTACAAGTCCTGAAG ACAACAGACATCAATAGCTCGGAGGTAGAGGTCTTGTATCTGAG

GAACGTGTCCGCTGAGGATGCAGGAGAGTATACCTGTCTGGCGGGCAACTCCATCGGCCTTTCCTACCAGTCAGCGTGGCTCACGGTGCTGCCAG AGGA

AGACCTCACGTGGACAACAGCAACCCCTGAGGCCAGATACACAGATATCATCCTGTATGTATCAGGCTCACTGGTTCTGCTTGTGCTCCTGCTGCTGGCC

GGGGTGTATCATCGGCAAGTCATCCGTGGCCACTACTCTCGCCAGCCTGTCACTATACAAAAGCTGTCCCGTTTCCCTTTGGCCCGACAG TTCTCTTTG

GAGTCGAGGTCCTCTGGCAAGTCAAGTTTGTCCCTGGTGCGAGGTGTCCGTCTCTCCTCCAGCGGCCCGCCCTTGCTCACGGGCCTTGTGAATCTAGACC

TGCCTCTCGATCCGCTTTGGGAATTCCCCCGGGACAG GTTGGTGCTCGGAAAGCCCCTGGGTGAGGGCTGCTTTGGGCAAGTGGTTCGTGCAGAGGCCT

TTGGTATGGATCCCTCCCGGCCCGACCAAACCAGCACCGTGGCTGTGAAGATGCTGAAAG ACAATGCCTCCGACAAGGATTTGGCAGACCTGGTCTCCG

AGATGGAGGTGATGAAGCTAATCGGAAGACACAAGAACATCATCAACCTGCTGGGTGTCTGCACTCAGGAAG GGCCCCTGTACGTGATTGTGGAATGTG

CCGCCAAGGGAAACCTTCGGGAATTCCTCCGTGCCCGGCGCCCCCCAGGCCCTGATCTCAGCCCTGATGGACCTCGGAGCAGCGAAGGACCACTCTCCTT

CCCGGCCCTAGTCTCCTGTGCCTACCAGGTGGCCCGAGGCATGCAGTATCTGGAGTCTCGGAAG - UNI31646 - TGCATCCACCGGGACCTGGCTG

CCCGAAATGTGCTGGTGACCGAGGATGATGTGATGAAGATCGCTGACTTTGGGCTGGCACGTGGTGTCCACCACATTGACTACTATAAGAAAACCAGCAA

C GGCCGCCTGCCAGTCAAATGGATGGCTCCAGAGGCATTGTTCGACCGCGTGTACACACACCAGAGTGACGT GTGGTCTTTCGGGATCCTGCTGTGGG

AAATCTTCACCCTCGGGGGCTCCCCATACCCTGGCATTCCGGTGGAGGAGCTCTTCTCACTGCTGCGAGAGGGGCACAGGATGGAGCGGCCCCCAAACTG

CCCCTCAGAGCT GTATGGGCTAATGAGGGAGTGCTGGCACGCAGCCCCATCTCAGAGGCCTACTTTTAAGCAGCTGGTGGAAGCTCTGGACAAGGTCCT

GCTGGCTGTCTCTGAAGAG TACCTTGACCTCCGCCTGACCTTTGGACCCTTTTCTCCCTCCAATGGGGATGCCAGCAGCACCTGCTCCTCCAGTGACTC

GGTTTTCAGCCACGACCCTTTGCCCCTCGAGCCAAGCCCCTTCCCTTTCTCTGACTCGCAGACGACATGAGCCGGGGAGCAGCAATGTTGTATGGGCTAC

GCGGCCCATGGCCGTGGGTCTCCTCGCTGAGCTGCAACCTGATGCATCGACATTTAATGTTGGCAGTGTCAGGCCTCTGACTTGAGACTACTGCTGTCGC

AGATCCTCTCTCTGGCCCTGTTTTGGGGAGGGCCATTCTTGGTCCTAAGGTTCATAGTTGAGGCCTTCTGTTCCAGCCTTATGCTCCCATCTCAGAGTTC

AACTCTCATCTCAAGATCATGGCCTTGCCCTTGGACTCATCCTCAGAGAAGTTAAGCATTAAGGCCTTGGCACGCAGCCTCCGTCTCCGGGGCTCTCCGG

GACTAGCTGCAAAACTTATGCTCTAAACATTTCTAGTTCCCCCAAACAACCTAGAGGCCTTGGGACTTCACATCCCCCAGCACACAAGCCTCACCACCCC

CTGCCATCCCCCCTCCATTGCTTGTTCCAGCATCTTGGTGAAAGGGGCATCAGCTCTGGTGTCCCTGAGAGACGAGAAGCCTGTGGGAACGACAGAAGAA

CATGGCATTTTTATAAATTATTTTTTTG
Translation
 MWLLLALLSIFQGTPALSLEASEEMEQE EPCLAPILEQQEQVLTVALGQPVRLCCGRTERGRHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYL

CLARGSMTVVHNLTLLMDD DSLTSISNDEDPKTLSSSSSGHVYPQQA APYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENR

IGGIR LRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLE ERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSS

FGADGFPYVQVLK TTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPE EEDLTWTTATPEARYTDIILYVSGSLVLLVLLLLAGVY

HRQVIRGHYSRQPVTIQKLSRFPLARQ FSLESRSSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDR RLVLGKPLGEGCFGQVVRAEAF

GMDPSRPDQTSTVAVKMLKD DNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQEG GPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGP

LSFPALVSCAYQVARGMQYLESRK - UNI31646 - CIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSN GRLPVKWMAPEALFDRVYTH

QSDV VWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSEL LYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEE YLDLRLTFGP

FSPSNGDASSTCSSSDSVFSHDPLPLEPSPFPFSDSQTT

For any suggestions or comments, please send an email to unitrap@crg.es