Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005370 (Msh6)
Chromosomal location
Chr 17: 88374424 - 88390403 (+)
Description
mutS homolog 6 (E. coli) Gene [Source:MGI Symbol;Acc:MGI:1343961]
RefSeq_dna
NM_010830 
RefSeq_peptide
NP_034960.1 
UniGene
Mm.18210 
MGI
MGI:1343961 
Uniprot/SWISSPROT
P54276 
Uniprot/SPTREMBL
Q61061 Q6GTK8 Q8C2N9 Q9CRH0 
Human Ortholog
ENSG00000116062 (MSH6)
Omim 600678 - MutS, E. COLI, HOMOLOG OF, 6  608089 - ENDOMETRIAL CANCER  
UniTrap UNI10886
Vector Insertion
Chr 17: 88374746 - 88379530
Public Clones (sanger) M066C02 (ggtc) E057H01 (ggtc) D134A12 (ggtc) D034B07 (ggtc)
D028D03 (ggtc) P132G03 (ggtc) E043F03 (ggtc) D047B03 (ggtc) P064F12 (ggtc)
P103F04 (ggtc) E021C11 (ggtc) D038E03 (ggtc) W173F02 (ggtc) E054E03 (ggtc)
D094H03 (ggtc) D029G12 (ggtc) 5SE284F10 (ggtc) P121F04 (ggtc) E039F03 (ggtc)
D044E11 (ggtc) D001C05 (ggtc) P004D05 (ggtc) E128F08 (ggtc) P120G10 (ggtc)
3SE284F10 (ggtc) P029E03 (ggtc) E039C12 (ggtc) D042C05 (ggtc) CMHD-GT_460H9-3 (cmhd)
IST12079B3 (tigm) IST13096D12 (tigm) IST14393H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5508
Vector Insertion
Chr 17: 88379731 - 88382784
Public Clones YTA071 (baygenomics) W052B01 (ggtc) PST12718-NR (escells)
Private Clones OST440380 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10647
Vector Insertion
Chr 17: 88386322 - 88387525
Public Clones A028B04 (ggtc) A025A01 (ggtc) W086A02 (ggtc) W057B06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005503
Sequence
GCGCGGTGGATGCGATCCTTGTAGGCGCTCGGAGCCGTGGCCCGGTCTGCCCGTCAGCCTTCATCATGTCCCGACAAAGCACCTTGTACAGCTTCTTCCC

CAAGTCCCCGGCACTCGGCGACACCAAGAAGGCCGCGGCCGAGGCCTCACGCCAAGGTGCCGCTGCCTCTGGAGCCTCCGCTTCCCGCGGCGGGGATGCG

GCCTGGAGCGAGGCTGAACCCGGGTCCCGGTCCGCGGCGGTATCCGCCTCGTCGCCGGAGGCAAAGGATCTCAACGGAGGGCTGCGGAGGGCCTCCTCCT

CCGCGCAGGCCGTGCCTCCCAG - UNI10886 - TTCTTGTGACTTCTCACCAGGTGATTTGGTTTGGGCTAAGATGGAAGGTTACCCCTGGTGGCCT

TGCCTAGTTTATAATCATCCCTTTGATGGAACGTTCATCCGGAAGAAAGGGAAATCTGTCCGTGTTCATGTACAGTTCTTTGATGACAGCCCAACAAGGG

GCTGGGTTAGCAAAAGGATGTTAAAGCCATATACAG - UNI5508 - GTTCAAAGTCAAAGGAAGCCCAAAAGGGAGGTCATTTCTACAGTTCAAAGT

CTGAGATACTCAGAGCAATGCAACGTGCAGATGAGGCCTTAAGTAAAGACACGGCTGAGAGGCTGCAGCTGGCAGTGTGTGATGAGCCTTCAGAGCCGGA

GGAGGAGGAGGAGACAGAG GTGCATGAGGCTTATTTATCTGATAAGAGTGAAGAGGATAATTACAACGAGAGTGAAGAAGAAGCACAGCCCAGTGTTCA

GGGGCCTAGGCGAAGCAGCCGGCAAGTCAAGAAGCGACGGGTCATCTCAGACTCGGAGAGTGACATTGGTGGCTCTGATGTAGAATTCAAGCCAGACACT

AAGCAGGAAGGAAGCAGTGATGACGCGAGCAGTGGAGTTGGGGACAGCGATAGTGAGGACCTAGGCACCTTTGGCAAAGGCGCTCCAAAGCGGAAGAGAG

CCATGGTTGCTCAGGGTGGACTTAGAAGGAAAAGTCTGAAGAAGGAAACAGGCTCAGCCAAACGAGCAACTCCCATTCTCTCAGAAACCAAGAGTACCTT

GAGCGCTTTTTCTGCCCCTCAGAATTCTGAATCCCAGACCCACGTCAGTGGAGGAGGTAACGACAGTAGTGGACCCACTGTTTGGTATCACGAAACTTTA

GAATGGCTTAAGCCAGAAAAGAGAAGAGATGAGCACAGGAGACGCCCCGATCACCCTGAATTTAACCCCACCACACTGTATGTGCCTGAAGAGTTCCTCA

ATTCTTGTACCCCAGGGATGAGGAAGTGGTGGCAGCTCAAGTCTCAGAACTTTGACCTCGTCATCTTTTATAAGGTGGGGAAGTTTTATGAGTTGTATCA

CATGGATGCTGTTATTGGAGTCAGTGAGCTGGGGCTGATATTCATGAAGGGCAACTGGGCCCATTCTGGTTTTCCAGAGATTGCGTTTGGCCGGTTCTCG

GATTCCTTGGTGCAGAAGGGCTATAAGGTAGCACGAGTGGAGCAGACCGAGACTCCAGAAATGATGGAGGCGCGATGTCGGAAAATGGCACACGTGTCCA

AGTTTGATAGAGTGGTGAGAAGGGAGATTTGCAGGATCATTACCAAGGGCACACAGACCTACAGTGTGCTGGATGGTGATCCCTCTGAGAACTACAGTAG

GTATCTTCTTAGCCTCAAAGAGAAGGAGGAAGAGACTTCTGGTCACACTCGTGTGTATGGTGTTTGCTTTGTGGACACTTCACTGGGCAAGTTTTTCATC

GGCCAGTTTTCGGATGACCGCCACTGTTCCAGATTTAGGACGCTAGTGGCTCACTATCCTCCAGTACAAATTTTGTTCGAGAAAGGAAATCTCTCAACAG

AGACCAAAACTGTCCTAAAGGGTTCACTGTCATCTTGTCTTCAGGAAGGTCTCATACCAGGTTCCCAATTTTGGGATGCCACTAAGACCTTGCGAACACT

CCTTGAAGGAGGGTACTTTACTGGAAATGGAGACAGTAGTACAGTGCTGCCTCTGGTGCTTAAAGGAATGACCTCGGAGTCAGATTCTGTTGGGTTGACA

CCAGGCGAGGAGAGTGAATTGGCTCTCTCTGCTCTAGGTGGTATTGTTTTCTACCTCAAAAAATGCCTGATTGATCAGGAGCTTCTGTCAATGGCTAATT

TTGAAGAGTATTTCCCTTTGGATTCTGACACGGTCAGCACAGTAAAACCTGGGGCTGTCTTTACTAAAGCCAGTCAGCGGATGGTGCTAGACGCAGTGAC

ATTAAACAACCTGGAGATTTTCCTGAATGGGACAAATGGCTCTACTGAAGGGACCCTGCTAGAGAGATTGGATACTTGCCATACGCCCTTTGGCAAGCGG

CTCTTAAAACAGTGGCTCTGTGCCCCCCTCTGCAGCCCTTCTGCCATCAGTGACCGTCTAGATGCGGTGGAAGATCTGATGGCCGTGCCTGACAAGGTCA

CTGAAGTTGCAGACCTCTTAAAGAAGCTGCCAGACCTTGAGAGGCTACTGAGTAAGATTCATAATGTTGGGTCTCCCCTGAAGAGCCAGAACCATCCAGA

CAGCAGGGCTATAATGTACGAAGAAACGACATACAGCAAAAAGAAGATCATTGATTTTCTCTCTGCTCTAGAAGGATTCAAAGTAATGTGTAAAGTCTCA

GGGCTTCTGGAGGAGGTCGCGGGTGGTTTTACGTCCAAAACCCTCAAGCAGGTTGTTACTCTGCAGTCAAAAAGTCCTAAAGGCCGCTTTCCTGACCTGA

CTGCAGAACTGCAGCGATGGGACACAGCCTTTGACCATGAGAAGGCTCGGAAGACCGGACTCATCACTCCAAAAGCAGGGTTTGACTCTGATTATGACCA

AGCACTTGCTGACATCAGAGAGAATGAACAGAGCCTCCTGGAGTACTTAGACAAACAGCGCAGTCGGCTTGGCTGTAAGAGCATAGTCTACTGGGGAATC

GGTAGGAACCGTTACCAGTTAGAGATTCCAGAGAATTTCGCTACCCGTAATCTACCTGAAGAATATGAGCTGAAATCTACTAAAAAAGGCTGTAAACGAT

ACTGGACCAAAACGATTGAGAAGAAATTAGCTAATCTTATTAATGCTGAAGAACGCAGGGACACATCCTTAAAGGACTGCATGCGGCGCTTGTTCTGTAA

CTTCGACAAGAACCACAAGGACTGGCAGTCTGCTGTAGAGTGCATTGCAGTGTTGG - UNI10647 - ATGTCTTACTGTGCCTGGCTAACTACAGTC

AAGGAGGAGATGGTCCTATGTGTCGCCCAGAAATTGTGTTACCAGGAGAAGACACACATCCCTTCTTAGAGTTTAAAGGGTCACGACATCCCTGCATTAC

AAAGACTTTTTTTGGAGACGATTTTATTCCTAACGACATTCTAATAGGCTGCGAGGAAGAAGCAGAGGAACATGGCAAAGCCTATTGTGTGCTTGTGACT

GGACCAAATATGGGGGGCAAGTCTACACTCATAAGACAG GCTGGTCTGTTGGCTGTGATGGCCCAGCTGGGTTGTTACGTACCTGCTGAGAAGTGCAGG

CTCACACCAGTTGACAGAGTGTTTACTAGGCTTGGTGCCTCAGATAGAATAATGTCAG GAGAAAGCACATTTTTTGTTGAGTTGAGTGAAACTGCTAGC

ATACTCAGGCATGCAACAGCACATTCTTTGGTACTTGTGGATGAATTAG GAAGAGGCACCGCAACTTTTGATGGGACAGCGATAGCCAATGCGGTTGTT

AAAGAACTTGCTGAAACCATAAAGTGTCGAACACTGTTTTCTACACACTATCATTCATTAGTAGAAGATTATTCTAAAAGTGTTTGTGTGCGCCTAGGAC

ATATG GCATGCATGGTAGAAAATGAATGTGAGGACCCCAGCCAGGAGACTATTACTTTCCTCTATAAATTCATTAAGGGAGCTTGTCCTAAGAGCTATG

GCTTTAATGCAGCAAGGCTTGCTAATCTCCCGGAGGAGGTTATTCAGAAGGGACACAGAAAGGCAAGAGAATTTGAGAGGATGAATCAGTCATTACAGCT

ATTTCG GGAAGTTTGTCTGGCTACTGAAAAGCCGACTATAAACGGTGAAGCTATCCATAGGCTGCTGGCCTTGATTAACGGATTGTAGACTACATTGGA

AGCTGAGCTGACTTTTGAAAAAGGTGGTAAATTCAGACAACATTATGATCTAATAAACTTTATTTTTAAAAAATGACCATTTTTCCATTTTCTTTCTAGG

AAATTAAACCCTTTTAATTCTTATCTACCTTCTACATAATGGTTATTGAATACTCCACAATATATTAAGTCTAGATGTTATGGTACATGCATACACTTTC

AGGCTGTTTATACCCACTGTCACCAATACACATAAATGGGGGGAGGG
Translation
MSRQSTLYSFFPKSPALGDTKKAAAEASRQGAAASGASASRGGDAAWSEAEPGSRSAAVSASSPEAKDLNGGLRRASSSAQAVPPS - UNI10886 - 

SSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIRKKGKSVRVHVQFFDDSPTRGWVSKRMLKPYTG - UNI5508 - GSKSKEAQKGGHFYSSKSE

ILRAMQRADEALSKDTAERLQLAVCDEPSEPEEEEETE VHEAYLSDKSEEDNYNESEEEAQPSVQGPRRSSRQVKKRRVISDSESDIGGSDVEFKPDTK

QEGSSDDASSGVGDSDSEDLGTFGKGAPKRKRAMVAQGGLRRKSLKKETGSAKRATPILSETKSTLSAFSAPQNSESQTHVSGGGNDSSGPTVWYHETLE

WLKPEKRRDEHRRRPDHPEFNPTTLYVPEEFLNSCTPGMRKWWQLKSQNFDLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSD

SLVQKGYKVARVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLDGDPSENYSRYLLSLKEKEEETSGHTRVYGVCFVDTSLGKFFIG

QFSDDRHCSRFRTLVAHYPPVQILFEKGNLSTETKTVLKGSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFTGNGDSSTVLPLVLKGMTSESDSVGLTP

GEESELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVSTVKPGAVFTKASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRL

LKQWLCAPLCSPSAISDRLDAVEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKVSG

LLEEVAGGFTSKTLKQVVTLQSKSPKGRFPDLTAELQRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLGCKSIVYWGIG

RNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDTSLKDCMRRLFCNFDKNHKDWQSAVECIAVLD - UNI10647 - D

VLLCLANYSQGGDGPMCRPEIVLPGEDTHPFLEFKGSRHPCITKTFFGDDFIPNDILIGCEEEAEEHGKAYCVLVTGPNMGGKSTLIRQ AGLLAVMAQL

GCYVPAEKCRLTPVDRVFTRLGASDRIMSG GESTFFVELSETASILRHATAHSLVLVDELG GRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSL

VEDYSKSVCVRLGHM ACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFERMNQSLQLFR REVCLATEKPTINGEA

IHRLLALINGL

For any suggestions or comments, please send an email to unitrap@crg.es