Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005442 (Cic)
Chromosomal location
Chr 7: 26055865 - 26079161 (+)
Description
capicua homolog (Drosophila) Gene [Source:MGI Symbol;Acc:MGI:1918972]
RefSeq_peptide
NP_001103601.1 NP_001103602.1 NP_082158.2 
UniGene
Mm.28833 
MGI
MGI:1918972 
Uniprot/SWISSPROT
Q924A2 
Human Ortholog
ENSG00000079432 (CIC)
Omim not available
UniTrap UNI5525
Vector Insertion
Chr 7: 26058653 - 26067197
Public Clones XE565 (baygenomics) CSA056 (baygenomics) CSA101 (baygenomics) YTA155 (baygenomics)
(ggtc) IST11176H12 (tigm) IST14969F10 (tigm) IST12522E4 (tigm) IST13084G3 (tigm)
IST14686G4 (tigm) IST11677F10 (tigm) IST13944C11 (tigm) IST11323C10 (tigm)
IST13115B5 (tigm) IST12268B10 (tigm) IST12326F12 (tigm) IST11367A1 (tigm)
IST11875F10 (tigm) IST14984C7 (tigm) IST12798D9BBF1 (tigm) IST14854D5 (tigm)
IST10980H2 (tigm) IST10371A3 (tigm) IST12994B11 (tigm) IST12593C8 (tigm)
IST13036D6 (tigm) IST13005B10 (tigm) IST14410B12 (tigm) IST14742F12 (tigm)
IST15084D5 (tigm) IST10246G11 (tigm) IST10614H10 (tigm) IST14883F7 (tigm)
IST15084C4 (tigm) IST12443D1 (tigm) IST14346D1 (tigm) IST13016A11 (tigm)
IST12837B5 (tigm) IST11394A4 (tigm) IST12437D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17470
Vector Insertion
Chr 7: 26067936 - 26069867
Public Clones IST10061E1 (tigm)
Private Clones OST442112 (lexicon) OST436357 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000005578
Sequence
GGGGGGAACGCTGCGGGGGGAGGGGAGCGCGTAGTAGTGGCGGGGCGGGGAGGCGGCGGTGGTTCGGCGCGGGGCTCGCTTGGAGCGCGCGGACGCTAGC

ACGCTAGTCCGTCTATCCGCCGGGGACCCGAGGTTGACCTGGTGTTCAGCCGCCGGCCCAGGGCCCGGAAAGGCGGGGCGGCGGCTCTGACTGCCGGGCG

CGCGGGGCCAGAGCCGTTACCCGCCGGAGCTTCGAGGGAGGGAGGGAGCAAGCGAGCCAGCGGAGAAGGGAGGGGGCCGCCCCCGCGCACGCGCGCCGCG

CCCCGCCCCGCCTGCCCCGCCTGCTGGACTCTGCGAGGGAGGAGGGAAAGGGAGGGGGCGGCGCCGATGGCCCCCGTGCCGCGCGCCCCGTGACGGCCCC

CGCGCGCGCCGGGGGGCGGGGCGGGGACGACTCTCGCTGACCTCCCCCGCCCCCTGGGCGGCGGGAGGCAGGCGGCGCTTTGCGCAGGCGCGCCCGGCGG

AGACCCCCGCGTGGGGTGGCCGGAGGGGGCTGTGGGGGGGGGGGGCATGCGGCGACGGCCTCCCGCTCCCCCCGGGCCGGAGCGGCGACGGCCAAGGAGC

GGGTTACGGGCAGAGCGGTGTCGGCCGCTGAGGAGGTGCGATCCCCTGTCGGGTTCCCGCTGCTCCGGACCATGTACTCGGCCCACAGGCCCCTGATACC

CGCGTCTGGCGCGGCCTCTCGTGGCCTCGGCATGTTCG - UNI17470 - TGTGGACAAATGTCGAACCTCGTTCTGTGGCTGTGTTCCCCTGGCACT

CCTTAGTCCCCTTCCTGGCACCCAGCCAGCCCGACCCCTCTGTGCAGCCTAGTGAGGCCCAGCAACCTGCCAGCCACCCTGTGGCCTCCAACCAGAGCAA

AG AACCTGCTGAGTCTGCTGCTGTTGCTCATGAGCAGCCACCAGGAGGGACGGGGGGTGCTGACCCTGGACGGCCCCCTGGAGCAGTGTGCCCTGAGAG

CCCAGGGCCTGGACCTCCACTTACTTTGGGTGGTGTGGATCCTGGTAAAAGTCTCCCCCCCACCACTGAGGAGGAGGCTCCTGGCCCTCCAGGAGAGCCC

CGGCTGGACAGTGAGACCGAGAGTGATCATGATGATGC CTTCCTCTCCATCATGTCTCCTGAGATTCAGTTGCCTCTGCCACCTGGAAAGCGCCGCACC

CAGTCTCTGAGTGCCTTGCCCAAGGAACGAGACTCATCTTCTGAAAAGGATGGACGAAGTCCTAACAAG CGGGAGAAGGACCATATTCGTCGGCCCATG

AATGCCTTCATGATCTTCAGCAAGCGGCACCGGGCCTTGGTCCACCAGCGGCACCCCAACCAGGACAACCGGACTGTCAGCAAGATCCTGGGCGAGTGGT

GGTACGCCCTGGGGCCCAAAGAGAAGCAGAAATACCACGACCTGGCCTTCCAG GTGAAAGAGGCCCACTTCAAGGCCCACCCAGATTGGAAATGGTGCA

ACAAGGACCGAAAGAAGTCCAGCTCAGAGGCCAAGCCTGCGAGCCTGGGTCTGGCAGGAGGGCACAAGGAGACGCGGGAACGGAGCATGTCGGAGACGGG

AACTGCTGCTGCCCCTGGGG TGTCTTCTGAGCTCCTGTCTGTTGCTGCCCAGACACTTTTGAGCTCGGACACCAAGGTTCCAGGGAGTGGCCCCTGTGG

AGCAGAACGGCTACACGCAGTTGGGGCACCTGGCTCAGCCCGACCCAGAGCCTTCTCCCACAGTGGGGTGCACAGTCTTGATGGTGGGGAAGTAGACAGC

CAAGCACTTCAAGAACTGACCCAG ATGGTTTCTGGCCCCGCATCATACTCCGGCCCAAAGCCTTCCCCCCAGTATGGTGCTCCAGGATCTTTTGCAGCT

CCTGGTGAAGGAGGTACCTTGGCCACTAGTGGGCGGCCTCCACTGTTGCCCTCCCGAGCCTCTCGTTCCCAGCGTGCAGCCAGTGAGGACATGACCAGTG

ATGAGGAGCGGATGGTCATCTGTGAGGAAGAAGGGGATGATGATGTCATTG CTGATGACAGCTTTGGCACCACCGACATTGATCTCAAGTGCAAGGAAC

GAGTGACTGACAGTGAAAGTGGAGACAGCTCTGGGGAGGACCCAGAGGGTAACAAG GGCTTTGGCCGTAAGGTGTTCTCACCTGTCATCCGCTCCTCCT

TTACCCATTGCCGTCCAACCCTGGACCCTGAGCCTCCAGGGCCCCCGGATCCACCTGCAGCCTTCAGCAAAGGCTACGGTCCCACCCCATCATCCTCCTC

TTCACCTGCTTCCACCTCAGTCTCAGTCTCCACCTCCTTTTCACTGGGCTCTGGAACCTTTAAGACCCAGGAGTCTGGTCAGGGCAGCACAGCGGTGCCA

CTACGGCCCCCACCCCCTGGAGCCGGGGGCCCAGCAACACCTTCCAAGGCCACTCGGTTTCCTCCTACGGATTCTGCCACCTTTCGGCGCAAGAGACCTG

AAAGTGTTGGTAGCCTTGAAGCACCAGGCCCCTCTGTCATTGCAGCACCTCCCAGTGGGGGAGGAAACCTTCTGCAGACACTGGTTCTGCCTCCGAGCAA

GGAGGATCGGGAGGGTACACGAGTGCCCTCAGCCCCAGCCCCACCACTGGCTTATGGGGCTCCCGCAGCCCCTCTGTGCCGCCCTGCTGCCACCATGGTC

ACCAATGTGGTACGGCCTGTCAGCAGCACTCCTGTGCCCATTGCCTCTAAGCCCTTTCCCACCTCTGGTCGGGCTGAGGCATCTTCAAATGACATAGCAG

GTGCCAGGACTGAAATGGGCACAGGATCCCGGGTGCCTGGGGGCTCCCCAATGGGTGTCAGTTTAGTGTATTCAGATAAGAAGTCAGCAGCAGCAGCCAC

CTCGCCAGCTCCACATTTGGTAGCTGGACCTTTATTGGGCACTGTGGGGAAGGCACCTGCTACTGTCACCAACTTGCTGGTAGGCACCCCAGGCTATGGG

GCTCCTGCATCGCCTGCTGTTCAGTTTATTGCCCAGGGAGCCCCAGGCAGTGCAACCCCTGCAGGCTCAGGAGCAAGTACTGGGAGTGGCCCCAATGGGC

CAGTACCCCTGGGCATCCTGCAGCCAGGTGCCCTAGGCAAGGCTGGGGGAATCACACAGGTGCAGTACATCCTGCCCACACTGCCCCAGCAGCTTCAAGT

GGCACCTGCCCCAGCACCAGCCCCTGGGACCAAGGCAGCAGCTCCCAGTGGCCCTGCACCCACCACCAGCATCCGTTTCACCCTCCCTCCGGGCACCTCG

ACCAACGGCAAGGTCCTGGCTGCCACTGCACCCACTGCTGGCATCCCTATCCTGCAGTCCGTACCCTCAGCCCCACCCCCTAAAG CCCAGTCAGTTTCT

CCTGTCCAGGCCACACCTTCAGGTGGCTCAGCCCAGCTGCTGCCTGGGAAGGTGCTAGTCCCCCTGGCTGCCCCTAGCATGTCAGTTCGAGGTGGAGGGG

CTGGTCAGCCACTGCCCCTGGTTAGCTCGCCTTTCTCAGTACCTGTCCAAAATGGTGCCCAACAACCTAGCAAG ATTATCCAGCTGACTCCTGTGCCTG

TGAGCACACCTAGTGGCCTGGTACCACCCCTGAGCCCAGCTACAATGCCGGGACCCACATCACAGCCTCAGAAGGTCCTGTTGCCCTCTTCCACAAG AA

TCACCTATGTACAGTCAGCAGGTGGGCACACTCTGCCTCTAGGCACCAGTTCTGCATGCAGTCAGACTGGAACAGTGACCTCATATGGGCCCACCAGCTC

TGTAGCTCTGGGCTTCACATCTTTGGGGCCCAGTGGTCCTGCCTTTGTACAGCCTCTGCTCTCAG CAGGCCAAGCTCCTTTGCTGGCTCCTGGCCAGGT

GGGCGTGTCACCTGTGCCTAGTCCCCAGTTGCCTCCTGCCTGTACAGCCTCTGGAGGTCCTGTCATAACAGCATTTTACCCTGGCAGCCCTGCACCCACT

TCAGCACCCCTGGGCCCACCTTCCCAAGCTCCGCCAAGCCTGGTCTACACTGTAGCCACCAGTACCACTCCACCTGCTGCTACCATTCTGCCCAAGGGCC

CACCAGCCTCTGCCACTGCCACTCCAGCCCCTACTAGTCCTTTCCCTAGCGCCACAG CGGCAGGCTCCATGACCTACAGCTTAGTGGCTCCCAAAGCTC

AGCGACCCAGCCCAAAAGCTCCCCAGAAAGTAAAGGCAGCCATTGCCAGCATTCCTGTGGGGTCTTTTGAATCGGGTACTACTGGGCGGCCTGGATCTAC

ACCCCGACAGTCTTCAGACTCTGGCGTAGCCAGAGAGCCTGCTGCCCCAGAATCAGAACTTGAGGGGCAGCCCACACCCCCAGCTCCCCCACCCCCCACA

GAGACCTGGCCTCCCACTGCCCGGAGCAGTCCCCCACCCCCCTTGCCTGCTGAGGAGCGACCTGGCACTAAAGGCCCTGAGACT GCCAGCAAATTCCCC

AGCTCATCTTCAGACTGGCGAGTTCCTGGGCTGGGCCTGGAGAGTCGTGGGGAGCCTCCTACCCCTCCCAGCCCAGCTCCAGCCACAGGCCCCAGTGGAA

GCAGCAGTGGCAGCAGCGAGGGCAGTAGTGGGAGGGCAGCTGGGGACACACCCGAGCGCAAGGAAGTCACTAGTTCTGGCAAGAAGATGAAGGTGCGGCC

CCCACCCCTGAAGAAGACCTTTGACTCTGTGGACAA CAGGGTCCTGTCAGAAGTGGACTTTGAAGAGCGGTTTGCTGAGCTGCCGGAGTTTAGACCAGA

GGAGGTGCTGCCCTCACCCACCCTGCAGTCTCTGGCCACCTCGCCTCGGGCTATCCTCGGCTCCTACCGAAAGAAGAGGAAGAATTCCACGG ACCTAGA

CTCAGCACCTGAAGATCCCACCTCACCCAAGCGCAAGATGAGGAGACGTTCGAGCTGCAGCTCAGAGCCCAACACCCCCAAGAGTGCCAAGTGCGAGGGG

GACATCTTCACCTTTGACCGCACAG GTACTGAGACAGAGGATGTGCTCGGGGAGCTGGAGTATGAGAAGGTGCCCTACTCATCACTGCGGCGCACCCTG

GACCAACGGCGGGCCCTGGTCATGCAGCTCTTCCAGGACCATGGCTTCTTCCCATCAG CCCAGGCCACAGCAGCCTTCCAGGCCCGCTACGCAGACATC

TTCCCATCCAAGGTGTGTCTGCAATTAAAGATCCGAGAGGTCCGCCAGAAGATCATGCAGGCAGCCACTCCCACAGAGCAGCCCCCTGGGGCTGAAGCCC

CCCTCCCTGGACCACCCCCTACTGGCATGGCTGCTACTCCTGTCCCCACTCCCAGCCCTGCTGGGGGCCCTGACCCCACCTCTCCAGGCTCGGACTCTGG

CACTGCCCAAGTTGCCCCGCCACTGCCTCCACCCCCAGAGCCTGGGCCTGGACAGCCTGGCTGGGAGGGGGCTCCCCAGCCCTCACCACCTCCCTCTGGC

CCTTCCACAGCTGCCACAGGCAGGTGAGGGGCCCTTGTTAAAGACCCCAGGACCCACAGTACCCCCCCCTCAGGATATGGACAGTATATAGATGGCAGGA

ATTGGGGGCCAGACAGTGGGATAGTTACCGCCTCCCCAGGAAGCCATTTGTCCTTTCCAGTTCGGCGCGGAATGTGGCCTGTTCCCTTGTATATATATTC

CCTCCCTGTGCTGGGGGCAGCAGGGGCAGATACCCTCCACTGAGCTCTTGTAGATAACCTGAAGTGTGTGACCTTCAGAGCTTTTCACTTGTACTTTATG

CAGAATGGCTCCTGTGAGGGCTGCAAGCTGGAGGGTAGTATGAGCCTTGGGCCACAGGGAGAAGATGCCTGTGGAGTAGTGGGGAGTTCATGCACCCCCC

TTTTTCCCCAGAGGGGCTGGACTCAGGTTAGTTTGGGGTGGGGGGGTTCCTGCACTTTGCCACAGGCATGGGGAGGATTCTCCCCACCCTCTGCCCTCCC

AACTTGGGTTGTACTTTCTAAGAAGGTGATTCCCCCTACCATTGTCCCCATTCCCAGAACAAAACATGTTGATCATGTGCAATATTTCTTACTGTGCCGA

GAAGCCGCAATGACCGAGATTAAAGCTGTTTAAC
Translation
MYSAHRPLIPASGAASRGLGMFV - UNI17470 - VWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQSKE EPAESAAVAHE

QPPGGTGGADPGRPPGAVCPESPGPGPPLTLGGVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDA AFLSIMSPEIQLPLPPGKRRTQSLSALPKER

DSSSEKDGRSPNK REKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQ VKEAHFKAHPDWKWCNKDRKKSSS

EAKPASLGLAGGHKETRERSMSETGTAAAPGV VSSELLSVAAQTLLSSDTKVPGSGPCGAERLHAVGAPGSARPRAFSHSGVHSLDGGEVDSQALQELT

Q MVSGPASYSGPKPSPQYGAPGSFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIA ADDSFGTTDIDLKCKERVTDS

ESGDSSGEDPEGNK GFGRKVFSPVIRSSFTHCRPTLDPEPPGPPDPPAAFSKGYGPTPSSSSSPASTSVSVSTSFSLGSGTFKTQESGQGSTAVPLRPP

PPGAGGPATPSKATRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPSKEDREGTRVPSAPAPPLAYGAPAAPLCRPAATMVTNVV

RPVSSTPVPIASKPFPTSGRAEASSNDIAGARTEMGTGSRVPGGSPMGVSLVYSDKKSAAAATSPAPHLVAGPLLGTVGKAPATVTNLLVGTPGYGAPAS

PAVQFIAQGAPGSATPAGSGASTGSGPNGPVPLGILQPGALGKAGGITQVQYILPTLPQQLQVAPAPAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTNGK

VLAATAPTAGIPILQSVPSAPPPKA AQSVSPVQATPSGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSSPFSVPVQNGAQQPSK IIQLTPVPVS

TPSGLVPPLSPATMPGPTSQPQKVLLPSSTR RITYVQSAGGHTLPLGTSSACSQTGTVTSYGPTSSVALGFTSLGPSGPAFVQPLLSA AGQAPLLAPG

QVGVSPVPSPQLPPACTASGGPVITAFYPGSPAPTSAPLGPPSQAPPSLVYTVATSTTPPAATILPKGPPASATATPAPTSPFPSATA AAGSMTYSLVA

PKAQRPSPKAPQKVKAAIASIPVGSFESGTTGRPGSTPRQSSDSGVAREPAAPESELEGQPTPPAPPPPTETWPPTARSSPPPPLPAEERPGTKGPET A

SKFPSSSSDWRVPGLGLESRGEPPTPPSPAPATGPSGSSSGSSEGSSGRAAGDTPERKEVTSSGKKMKVRPPPLKKTFDSVDN NRVLSEVDFEERFAEL

PEFRPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTD DLDSAPEDPTSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTG GTETEDVLGELEYEKV

PYSSLRRTLDQRRALVMQLFQDHGFFPSA AQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPGPPPTGMAATPVPTPSPAGG

PDPTSPGSDSGTAQVAPPLPPPPEPGPGQPGWEGAPQPSPPPSGPSTAATGR
Transcript ENSMUST00000094696
Sequence
ATGAAGCCAATGAAGAAGGCATGCCCTGGCCTTGCAGGTTCCGCCAGTGGCAGCAAGTCCCCACCAGCTACCAGGGCCAAGGCTTTGAGACGGCGAGGGG

CCGGGGAGGGTGACAAGCCAGAGGAGGAGGAGGAGGCACAGCCACAGGAGCAGGCAGGGCCAGAAGAGGCTGAAGAGGGTGAGGAAGAGGAGGCTGAGCG

GGACCCTGGAGCTGAGGGAACACATCCAGAGCTGCAGCCCAATGATCCTACTCCAGGCCTAACTGAGGACCCTAAGGGGGATGGGGAGGCAGGCCGCTGG

GAGCCCTCACTCAGTCGCAAGACAGCCACATTCAAGTCTCGGGCCCCGAAGAAGAAATATGTGGAGGAGCATGGCACTGGAAATGTTGGTGTGGTAGGAG

CCCCTGAAGAGCGGGAGCGGACGCCTGAGGACGCCAGTGCCCTGGGTGTGCCTCCTCGGCCACCCACCTCCACTCGGTCCTCCTCTACTGACACGGCCAG

TGAGCACTCAGCCGACCTGGAGGACGAGCCCCCTGAGGCTTGTGGTCCAGGCCCCTGGCCCTCTACAGGCACCAGTGAAGGCTATGACCTGCGGCAACTG

AGGTCTCAGCGGGTGCTGGCTCGGCGTGGTGATGGCCTCTTCCTGCCTGCAGTCGTGCGCCAGGTGCGCCGTAGCCAGGACTTGGGTGTGCAGTTCCCTG

GGGACCGTGCCTTGACTTTCTATGAAGGAGTACCCGGTGGTGGTGTGGACGTTGTTTTGGATGTCACACCACCTCCAGGTGCACTGATGGTGGGCACGGC

TGTCTGCACTTGTGTGGAACCTGGTGTGGCTGCCTACCGAGAGGGTGTAGTGGTGGAAGTGGCCACTAAACCAGCTGCCTATAAGGTCCGCCTCAGCCCT

GGCCCCAGCTCCCATGCAGGCCCACCAGGCACACTGCCACAAGCCCAACAGACACTGCACCGTGAGCCTGAGGAGGCTGTCTGGGTTACTCGCTCTAGCC

TGCGCCTGCTTCGGCCCCCCTGGGAACCTGGGGCCTTGCTGAGGAAGCACCCTGCAGGCCCAGAGGAGGAGCAGGCAGAGCCTGGGCCCGCTTTGCCTCC

TTGTCCTTCTTCCGTGGAGCCCAAGCAACCTGAGGATGCTGAGGTCTCCAACATCAGCTTTGGTAGCAACCTGGGGACTCGCTGCGAGGAGGGGGAGGAG

AAGCACCCACCATCCCTGGGCACCCCTGTCCTGCTCCCACTGCCTCCACCCCAGCTCCTGTCACCACCCCCGAAGTCCCCAGCCTTTGGTGGCCCTGGCC

GCCCTAGTGAGCAGCCTTCGCCCTGCCAGGAAGGGAGCCAGGGTGGCAGCCGCAGTAGCAGTGTGGCCTCACTGGAGAAGGGAGCTGCACCAGCAGCCCG

TGCTCGCACGCCATTGACAGCCGCCCAGCAGAAGTACAAGAAGGGCGACGTGGTCTGCACGCCCAATGGCATCCGAAAGAAGTTCAATGGCAAGCAGTGG

CGCCGGCTGTGCTCTCGGGATGGCTGCATGAAGGAGTCCCAGCGGCGCGGGTACTGCTCGCGCCACTTGTCCATGAGAACCAAAGAGATGGAGGGCCTGG

CAGACAGTGGGCCAGGTGGGACTGGGCGGCCTGCGGGTGTGGCAGCCCGGGAAGGAAGCACTGAGTTTGACTGGGGCGATGAGACTTCGAGGGACAGTGA

GGCCAGCAGTGTGGCAGCCCGGGGAGACTCCCGCCCACGTCTAGTGGCGCCTGCTGACCTGTCACGCTTCGAGTTTGATGAGTGTGAGGCGGCTGTGATG

TTGGTGTCACTTGGCAGCTCCCGCTCAGGCACACCTTCCTTCTCTCCGGTCTCTACACAGTCGCCCTTCTCTCCAGCCCCCTCTCCCTCACCCTCGCCGC

TCTTTGGCTTCCGCCCTGCCAATTTCAGCCCCATAAATGCCTCACCTGTCATCCAACGCACTGCTGTTCGCAGCCGCCACCTGAGCGCCAGCACCCCTAA

GGCAGGCGTGCTGACACCACCAGACCTGGGCCCCCACCCACCGCCACCTGCCCCTCGTGAGCGCCATTCCTCTGGCATCCTACCCACCTTCCAGACCAAC

CTAACCTTTACTGTGCCCATTAGCCCTGGGCGGAGGAAGACAGAACTGCTGCCCCATCCAGGGACATTGGGGGCCTCCGGAGCAGGAGGTGGGGGAGCCG

CCCCAGACTTCCCCAAGAGTGACAGCTTAGACTCTGGAGTGGACTCCGTGTCCCACACACCTACCCCCTCCACACCGGCTGGCTTCCGAGCTGTGTCACC

GGCTGTGCCCTTCTCTCGCTCCCGCCAGCCTTCACCATTGCTGCTGTTGCCCCCACCTGCTGGACTCACCTCAGATCCAGGGCCCTCTGTGCGAAGGGTA

CCCGCCGTGCAGCGGGACTCACCTGTCATTGTCCGCAACCCCGATGTGCCACTGCCTTCCAAATTCCCTGGAGAGGTGGGCACTGCCGGTGAGGCACGGG

CCGGGGGACCTGGACGGAGTTGCCGTGAGACCCCAGTGCCCCCTGGGGTGGCCAGCGGGAAACCTGGCCTGCCTCCACCTCTGCCTGCCCCTGTGCCCAT

CACTGTGCCTCCAGCCGCACCGACTGCTGTGGCCCAGCCGATGCCCACCTTGGGCCTGGCTTCTTCACCCTTCCAGCCCGTGGCCTTTCACCCTTCACCT

GCTGCCCTGTTGCCAGTTCTAGTGCCGAGCAGCTATCCCAGCCACCCTGCCCCCAAGAAGGAAGTCATCATGGGCAGGCCCGGAACAG - UNI5525 -

 - UNI17470 - TGTGGACAAATGTCGAACCTCGTTCTGTGGCTGTGTTCCCCTGGCACTCCTTAGTCCCCTTCCTGGCACCCAGCCAGCCCGACCCC

TCTGTGCAGCCTAGTGAGGCCCAGCAACCTGCCAGCCACCCTGTGGCCTCCAACCAGAGCAAAG AACCTGCTGAGTCTGCTGCTGTTGCTCATGAGCAG

CCACCAGGAGGGACGGGGGGTGCTGACCCTGGACGGCCCCCTGGAGCAGTGTGCCCTGAGAGCCCAGGGCCTGGACCTCCACTTACTTTGGGTGGTGTGG

ATCCTGGTAAAAGTCTCCCCCCCACCACTGAGGAGGAGGCTCCTGGCCCTCCAGGAGAGCCCCGGCTGGACAGTGAGACCGAGAGTGATCATGATGATGC

 CTTCCTCTCCATCATGTCTCCTGAGATTCAGTTGCCTCTGCCACCTGGAAAGCGCCGCACCCAGTCTCTGAGTGCCTTGCCCAAGGAACGAGACTCATC

TTCTGAAAAGGATGGACGAAGTCCTAACAAG CGGGAGAAGGACCATATTCGTCGGCCCATGAATGCCTTCATGATCTTCAGCAAGCGGCACCGGGCCTT

GGTCCACCAGCGGCACCCCAACCAGGACAACCGGACTGTCAGCAAGATCCTGGGCGAGTGGTGGTACGCCCTGGGGCCCAAAGAGAAGCAGAAATACCAC

GACCTGGCCTTCCAG GTGAAAGAGGCCCACTTCAAGGCCCACCCAGATTGGAAATGGTGCAACAAGGACCGAAAGAAGTCCAGCTCAGAGGCCAAGCCT

GCGAGCCTGGGTCTGGCAGGAGGGCACAAGGAGACGCGGGAACGGAGCATGTCGGAGACGGGAACTGCTGCTGCCCCTGGGG TGTCTTCTGAGCTCCTG

TCTGTTGCTGCCCAGACACTTTTGAGCTCGGACACCAAGGTTCCAGGGAGTGGCCCCTGTGGAGCAGAACGGCTACACGCAGTTGGGGCACCTGGCTCAG

CCCGACCCAGAGCCTTCTCCCACAGTGGGGTGCACAGTCTTGATGGTGGGGAAGTAGACAGCCAAGCACTTCAAGAACTGACCCAG ATGGTTTCTGGCC

CCGCATCATACTCCGGCCCAAAGCCTTCCCCCCAGTATGGTGCTCCAGGATCTTTTGCAGCTCCTGGTGAAGGAGGTACCTTGGCCACTAGTGGGCGGCC

TCCACTGTTGCCCTCCCGAGCCTCTCGTTCCCAGCGTGCAGCCAGTGAGGACATGACCAGTGATGAGGAGCGGATGGTCATCTGTGAGGAAGAAGGGGAT

GATGATGTCATTG CTGATGACAGCTTTGGCACCACCGACATTGATCTCAAGTGCAAGGAACGAGTGACTGACAGTGAAAGTGGAGACAGCTCTGGGGAG

GACCCAGAGGGTAACAAG GGCTTTGGCCGTAAGGTGTTCTCACCTGTCATCCGCTCCTCCTTTACCCATTGCCGTCCAACCCTGGACCCTGAGCCTCCA

GGGCCCCCGGATCCACCTGCAGCCTTCAGCAAAGGCTACGGTCCCACCCCATCATCCTCCTCTTCACCTGCTTCCACCTCAGTCTCAGTCTCCACCTCCT

TTTCACTGGGCTCTGGAACCTTTAAGACCCAGGAGTCTGGTCAGGGCAGCACAGCGGTGCCACTACGGCCCCCACCCCCTGGAGCCGGGGGCCCAGCAAC

ACCTTCCAAGGCCACTCGGTTTCCTCCTACGGATTCTGCCACCTTTCGGCGCAAGAGACCTGAAAGTGTTGGTAGCCTTGAAGCACCAGGCCCCTCTGTC

ATTGCAGCACCTCCCAGTGGGGGAGGAAACCTTCTGCAGACACTGGTTCTGCCTCCGAGCAAGGAGGATCGGGAGGGTACACGAGTGCCCTCAGCCCCAG

CCCCACCACTGGCTTATGGGGCTCCCGCAGCCCCTCTGTGCCGCCCTGCTGCCACCATGGTCACCAATGTGGTACGGCCTGTCAGCAGCACTCCTGTGCC

CATTGCCTCTAAGCCCTTTCCCACCTCTGGTCGGGCTGAGGCATCTTCAAATGACATAGCAGGTGCCAGGACTGAAATGGGCACAGGATCCCGGGTGCCT

GGGGGCTCCCCAATGGGTGTCAGTTTAGTGTATTCAGATAAGAAGTCAGCAGCAGCAGCCACCTCGCCAGCTCCACATTTGGTAGCTGGACCTTTATTGG

GCACTGTGGGGAAGGCACCTGCTACTGTCACCAACTTGCTGGTAGGCACCCCAGGCTATGGGGCTCCTGCATCGCCTGCTGTTCAGTTTATTGCCCAGGG

AGCCCCAGGCAGTGCAACCCCTGCAGGCTCAGGAGCAAGTACTGGGAGTGGCCCCAATGGGCCAGTACCCCTGGGCATCCTGCAGCCAGGTGCCCTAGGC

AAGGCTGGGGGAATCACACAGGTGCAGTACATCCTGCCCACACTGCCCCAGCAGCTTCAAGTGGCACCTGCCCCAGCACCAGCCCCTGGGACCAAGGCAG

CAGCTCCCAGTGGCCCTGCACCCACCACCAGCATCCGTTTCACCCTCCCTCCGGGCACCTCGACCAACGGCAAGGTCCTGGCTGCCACTGCACCCACTGC

TGGCATCCCTATCCTGCAGTCCGTACCCTCAGCCCCACCCCCTAAAG CCCAGTCAGTTTCTCCTGTCCAGGCCACACCTTCAGGTGGCTCAGCCCAGCT

GCTGCCTGGGAAGGTGCTAGTCCCCCTGGCTGCCCCTAGCATGTCAGTTCGAGGTGGAGGGGCTGGTCAGCCACTGCCCCTGGTTAGCTCGCCTTTCTCA

GTACCTGTCCAAAATGGTGCCCAACAACCTAGCAAG ATTATCCAGCTGACTCCTGTGCCTGTGAGCACACCTAGTGGCCTGGTACCACCCCTGAGCCCA

GCTACAATGCCGGGACCCACATCACAGCCTCAGAAGGTCCTGTTGCCCTCTTCCACAAG AATCACCTATGTACAGTCAGCAGGTGGGCACACTCTGCCT

CTAGGCACCAGTTCTGCATGCAGTCAGACTGGAACAGTGACCTCATATGGGCCCACCAGCTCTGTAGCTCTGGGCTTCACATCTTTGGGGCCCAGTGGTC

CTGCCTTTGTACAGCCTCTGCTCTCAG GCCAAGCTCCTTTGCTGGCTCCTGGCCAGGTGGGCGTGTCACCTGTGCCTAGTCCCCAGTTGCCTCCTGCCT

GTACAGCCTCTGGAGGTCCTGTCATAACAGCATTTTACCCTGGCAGCCCTGCACCCACTTCAGCACCCCTGGGCCCACCTTCCCAAGCTCCGCCAAGCCT

GGTCTACACTGTAGCCACCAGTACCACTCCACCTGCTGCTACCATTCTGCCCAAGGGCCCACCAGCCTCTGCCACTGCCACTCCAGCCCCTACTAGTCCT

TTCCCTAGCGCCACAG GCTCCATGACCTACAGCTTAGTGGCTCCCAAAGCTCAGCGACCCAGCCCAAAAGCTCCCCAGAAAGTAAAGGCAGCCATTGCC

AGCATTCCTGTGGGGTCTTTTGAATCGGGTACTACTGGGCGGCCTGGATCTACACCCCGACAGTCTTCAGACTCTGGCGTAGCCAGAGAGCCTGCTGCCC

CAGAATCAGAACTTGAGGGGCAGCCCACACCCCCAGCTCCCCCACCCCCCACAGAGACCTGGCCTCCCACTGCCCGGAGCAGTCCCCCACCCCCCTTGCC

TGCTGAGGAGCGACCTGGCACTAAAGGCCCTGAGACT GCCAGCAAATTCCCCAGCTCATCTTCAGACTGGCGAGTTCCTGGGCTGGGCCTGGAGAGTCG

TGGGGAGCCTCCTACCCCTCCCAGCCCAGCTCCAGCCACAGGCCCCAGTGGAAGCAGCAGTGGCAGCAGCGAGGGCAGTAGTGGGAGGGCAGCTGGGGAC

ACACCCGAGCGCAAGGAAGTCACTAGTTCTGGCAAGAAGATGAAGGTGCGGCCCCCACCCCTGAAGAAGACCTTTGACTCTGTGGACAA GGTCCTGTCA

GAAGTGGACTTTGAAGAGCGGTTTGCTGAGCTGCCGGAGTTTAGACCAGAGGAGGTGCTGCCCTCACCCACCCTGCAGTCTCTGGCCACCTCGCCTCGGG

CTATCCTCGGCTCCTACCGAAAGAAGAGGAAGAATTCCACGG ACCTAGACTCAGCACCTGAAGATCCCACCTCACCCAAGCGCAAGATGAGGAGACGTT

CGAGCTGCAGCTCAGAGCCCAACACCCCCAAGAGTGCCAAGTGCGAGGGGGACATCTTCACCTTTGACCGCACAG GTACTGAGACAGAGGATGTGCTCG

GGGAGCTGGAGTATGAGAAGGTGCCCTACTCATCACTGCGGCGCACCCTGGACCAACGGCGGGCCCTGGTCATGCAGCTCTTCCAGGACCATGGCTTCTT

CCCATCAG CCCAGGCCACAGCAGCCTTCCAGGCCCGCTACGCAGACATCTTCCCATCCAAGGTGTGTCTGCAATTAAAGATCCGAGAGGTCCGCCAGAA

GATCATGCAGGCAGCCACTCCCACAGAGCAGCCCCCTGGGGCTGAAGCCCCCCTCCCTGGACCACCCCCTACTGGCATGGCTGCTACTCCTGTCCCCACT

CCCAGCCCTGCTGGGGGCCCTGACCCCACCTCTCCAGGCTCGGACTCTGGCACTGCCCAAGTTGCCCCGCCACTGCCTCCACCCCCAGAGCCTGGGCCTG

GACAGCCTGGCTGGGAGGGGGCTCCCCAGCCCTCACCACCTCCCTCTGGCCCTTCCACAGCTGCCACAGGCAGGTGAGGGGCCCTTGTTAAAGACCCCAG

GACCCACAGTACCCCCCCCTCAGGATATGGACAGTATATAGATGGCAGGAATTGGGGGCCAGACAGTGGGATAGTTACCGCCTCCCCAGGAAGCCATTTG

TCCTTTCCAGTTCGGCGCGGAATGTGGCCTGTTCCCTTGTATATATATTCCCTCCCTGTGCTGGGGGCAGCAGGGGCAGATACCCTCCACTGAGCTCTTG

TAGATAACCTGAAGTGTGTGACCTTCAGAGCTTTTCACTTGTACTTTATGCAGAATGGCTCCTGTGAGGGCTGCAAGCTGGAGGGTAGTATGAGCCTTGG

GCCACAGGGAGAAGATGCCTGTGGAGTAGTGGGGAGTTCATGCACCCCCCTTTTTCCCCAGAGGGGCTGGACTCAGGTTAGTTTGGGGTGGGGGGGTTCC

TGCACTTTGCCACAGGCATGGGGAGGATTCTCCCCACCCTCTGCCCTCCCAACTTGGGTTGTACTTTCTAAGAAGGTGATTCCCCCTACCATTGTCCCCA

TTCCCAGAACAAAACATGTTGATCATGTGCAATATTTCTTACTGTGCCGAGAAGCCGCAATGACCGAGATTAAAGCTGTTTAAC
Translation
MKPMKKACPGLAGSASGSKSPPATRAKALRRRGAGEGDKPEEEEEAQPQEQAGPEEAEEGEEEEAERDPGAEGTHPELQPNDPTPGLTEDPKGDGEAGRW

EPSLSRKTATFKSRAPKKKYVEEHGTGNVGVVGAPEERERTPEDASALGVPPRPPTSTRSSSTDTASEHSADLEDEPPEACGPGPWPSTGTSEGYDLRQL

RSQRVLARRGDGLFLPAVVRQVRRSQDLGVQFPGDRALTFYEGVPGGGVDVVLDVTPPPGALMVGTAVCTCVEPGVAAYREGVVVEVATKPAAYKVRLSP

GPSSHAGPPGTLPQAQQTLHREPEEAVWVTRSSLRLLRPPWEPGALLRKHPAGPEEEQAEPGPALPPCPSSVEPKQPEDAEVSNISFGSNLGTRCEEGEE

KHPPSLGTPVLLPLPPPQLLSPPPKSPAFGGPGRPSEQPSPCQEGSQGGSRSSSVASLEKGAAPAARARTPLTAAQQKYKKGDVVCTPNGIRKKFNGKQW

RRLCSRDGCMKESQRRGYCSRHLSMRTKEMEGLADSGPGGTGRPAGVAAREGSTEFDWGDETSRDSEASSVAARGDSRPRLVAPADLSRFEFDECEAAVM

LVSLGSSRSGTPSFSPVSTQSPFSPAPSPSPSPLFGFRPANFSPINASPVIQRTAVRSRHLSASTPKAGVLTPPDLGPHPPPPAPRERHSSGILPTFQTN

LTFTVPISPGRRKTELLPHPGTLGASGAGGGGAAPDFPKSDSLDSGVDSVSHTPTPSTPAGFRAVSPAVPFSRSRQPSPLLLLPPPAGLTSDPGPSVRRV

PAVQRDSPVIVRNPDVPLPSKFPGEVGTAGEARAGGPGRSCRETPVPPGVASGKPGLPPPLPAPVPITVPPAAPTAVAQPMPTLGLASSPFQPVAFHPSP

AALLPVLVPSSYPSHPAPKKEVIMGRPGTV - UNI5525 - - UNI17470 - VWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPV

ASNQSKE EPAESAAVAHEQPPGGTGGADPGRPPGAVCPESPGPGPPLTLGGVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDA AFLSIMSPEIQL

PLPPGKRRTQSLSALPKERDSSSEKDGRSPNK REKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQ VKEAH

FKAHPDWKWCNKDRKKSSSEAKPASLGLAGGHKETRERSMSETGTAAAPGV VSSELLSVAAQTLLSSDTKVPGSGPCGAERLHAVGAPGSARPRAFSHS

GVHSLDGGEVDSQALQELTQ MVSGPASYSGPKPSPQYGAPGSFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIA AD

DSFGTTDIDLKCKERVTDSESGDSSGEDPEGNK GFGRKVFSPVIRSSFTHCRPTLDPEPPGPPDPPAAFSKGYGPTPSSSSSPASTSVSVSTSFSLGSG

TFKTQESGQGSTAVPLRPPPPGAGGPATPSKATRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPSKEDREGTRVPSAPAPPLAY

GAPAAPLCRPAATMVTNVVRPVSSTPVPIASKPFPTSGRAEASSNDIAGARTEMGTGSRVPGGSPMGVSLVYSDKKSAAAATSPAPHLVAGPLLGTVGKA

PATVTNLLVGTPGYGAPASPAVQFIAQGAPGSATPAGSGASTGSGPNGPVPLGILQPGALGKAGGITQVQYILPTLPQQLQVAPAPAPAPGTKAAAPSGP

APTTSIRFTLPPGTSTNGKVLAATAPTAGIPILQSVPSAPPPKA AQSVSPVQATPSGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSSPFSVPVQ

NGAQQPSK IIQLTPVPVSTPSGLVPPLSPATMPGPTSQPQKVLLPSSTR RITYVQSAGGHTLPLGTSSACSQTGTVTSYGPTSSVALGFTSLGPSGPA

FVQPLLSG GQAPLLAPGQVGVSPVPSPQLPPACTASGGPVITAFYPGSPAPTSAPLGPPSQAPPSLVYTVATSTTPPAATILPKGPPASATATPAPTSP

FPSATG GSMTYSLVAPKAQRPSPKAPQKVKAAIASIPVGSFESGTTGRPGSTPRQSSDSGVAREPAAPESELEGQPTPPAPPPPTETWPPTARSSPPPP

LPAEERPGTKGPET ASKFPSSSSDWRVPGLGLESRGEPPTPPSPAPATGPSGSSSGSSEGSSGRAAGDTPERKEVTSSGKKMKVRPPPLKKTFDSVDK 

KVLSEVDFEERFAELPEFRPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTD DLDSAPEDPTSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTG G

TETEDVLGELEYEKVPYSSLRRTLDQRRALVMQLFQDHGFFPSA AQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPGPPPT

GMAATPVPTPSPAGGPDPTSPGSDSGTAQVAPPLPPPPEPGPGQPGWEGAPQPSPPPSGPSTAATGR

For any suggestions or comments, please send an email to unitrap@crg.es