Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005481 (Ddx39)
Chromosomal location
Chr 8: 86239167 - 86247247 (+)
Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 Gene [Source:MGI (curated);Acc:Ddx39-001]
RefSeq_dna
NM_197982 
RefSeq_peptide
NP_932099.2 
UniGene
Mm.28222 
MGI
MGI:1915528 
Uniprot/SWISSPROT
Q8VDW0 
Uniprot/SPTREMBL
Q3T9L0 Q3TIE4 Q3TPL7 Q3U837 Q3UAF1 Q3UVN0 
Human Ortholog
ENSG00000123136 (DDX39)
Omim not available
UniTrap UNI10950
Vector Insertion
Chr 8: 86239237 - 86239446
Public Clones E132C04 (ggtc) P127F10 (ggtc) D131C04 (ggtc) W221E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11567
Vector Insertion
Chr 8: 86239746 - 86243285
Public Clones P067E02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15525
Vector Insertion
Chr 8: 86239746 - 86243285
Public Clones (sanger) P127F10 (ggtc) D086C02 (ggtc) P126D06 (ggtc) P133G11 (ggtc)
P116E02 (ggtc) PST9455-NR (escells) IST14477H7 (tigm) IST13248A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21674
Vector Insertion
Chr 8: 86243285 - 86243498
Public Clones not available
Private Clones OST321491 (lexicon) OST318895 (lexicon) OST301720 (lexicon) OST277886 (lexicon)
OST220369 (lexicon) OST213087 (lexicon) OST203460 (lexicon) OST189738 (lexicon)
OST177198 (lexicon) OST92804 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3972
Vector Insertion
Chr 8: 86245632 - 86245752
Public Clones AS0038 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116451
Sequence
GTCCAGGGTCGCGGCGTAGAACCGGACGGGTGGCTCTCTTTGCAGCTCGCGGAGGCGAACCGGGCGGCAG - UNI10950 - - UNI11567 - - U

NI15525 - - UNI21674 - TGCCATGGCAGAACAGGATGTGGAAAATGAACTTTTGGATTATGATGAAGATGAAGAGCCCCAGGCACCCCAGGAGA

GCACTCCAGCTCCCCCGAAGAAAGATGTCAAAGGATCTTATGTCTCCATCCACAGTTCTGGCTTCCGGGACTTTCTACTGAAGCCAGAGCTCCTGAGAGC

TATAGTTGACTGTGGCTTTGAGCATCCTTCAGAGG - UNI21674 - TCCAGCATGAGTGTATTCCCCAGGCCATTCTGGGTATGGATGTCCTGTGCC

AGGCCAAGTCTGGGATGGGCAAGACAGCTGTGTTTGTGCTGGCCACCCTGCAGCAGATTGAGCCTGTCAATGGCCAG GTATCAGTCCTGGTCATGTGCC

ACACGAGGGAGCTGGCCTTCCAGATCAGCAAGGAGTATGAGCGCTTCTCTAAGTACATGCCCAGTGTTAAG GTTTCTGTGTTCTTTGGAGGCCTCTCCA

TTAAGAAGGATGAAGATGTGTTGAAGAAGAACTGTCCTCATGTTGTGGTGGGGACACCAGGCCGGATCCTGGCACTTGTGCGGAGCAGGAGCCTCAACCT

GAGGAATGTGAAGCACTTTGTGCTAGATGAATGTGACAAGATGCTGGAACAGCTGG GCTCCCTTTCCTGAAGCGTGGCTCAAGGCGCACTGGCAGCCGC

TCCATGCTGGCAGCGA - UNI3972 - ACATGCGCCGGGATGTACAGGAGATCTTTCGTCTGACACCCCACGAGAAGCAGTGTATGATGTTCAGCGCC

ACCCTGAGCAAGGAGATCCGGCCAGTCTGCAGGAAGTTCATGCAGGAT - UNI3972 - CCTATGGAGGTGTTTGTGGACGACGAGACCAAGCTCACA

CTGCATGGGCTGCAGCAGTATTACGTCAAGCTCAAGGACAGTGAGAAGAACCGTAAGCTCTTCGACCTCCTCGACGTGCTAGAGTTTAACCAG GTGGTG

ATCTTTGTCAAGTCTGTGCAACGCTGCATGGCCCTGGCCCAGCTCCTAGTGGAGCAGAATTTCCCAGCTATCGCTATTCACCGAGGCATGGCCCAGGAGG

AGCG CCTGTCCCGATACCAGCAGTTCAAGGACTTCCAGCGACGAATCCTGGTGGCTACTAATCTGTTTGGCAGAGGTATGGACATTGAGCGAGTCAACA

TTGTCTTCAACTATGACATGCCAGAGGACTCAGACACCTACCTTCACCGA GTGGCTCGTGCTGGTCGCTTTGGTACCAAGGGCCTGGCAGTCACTTTTG

TATCGGATGAAAATGATGCCAAAATCCTTAATGATGTTCAGGACCGGTTTGAAGTGAATGTAGCTGAGCTTCCAGAGGAAATAGATATCTCCACATACA 

TTGAGCAGAGCCGGTAACCGTATGTGTAGCCAGGGCAACATGGCCACTCTCTTTCCCACCTGCTGCTTCAGAACCTCTTTCTAGGTGACAAATCGATGTC

TCTTTTTATTGTTCCAAAGCTTTAGTGATGTAAGAATAAACTTTTATTGTG
Translation
 - UNI10950 - - UNI11567 - - UNI15525 - - UNI21674 -  - UNI21674 -     - UNI3972 -  - UNI3972 - MEVF

VDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQ VVIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEER RLSRYQQFKDFQRRILVATNLF

GRGMDIERVNIVFNYDMPEDSDTYLHR VARAGRFGTKGLAVTFVSDENDAKILNDVQDRFEVNVAELPEEIDISTYI IEQSR
Transcript ENSMUST00000109810
Sequence
GCGGCTCTCGGAGGCCCCATGTGTACCGTGGTGGGATTGAGGGACCGGGCGGATCCACACTGCGTTTTCGGTCACGGCGAGAGGACTCAGGCTATCTGGG

CAGACGTCCCGAGTCTGCAGTCACCGGCTTCCCGTCTTGTTCCGCCGCTCGCCCAGGAGATTCTTCTCCAGACTCTGATGCGGAAGGCCAGTGTCGCGCC

TCTTAGGAACGTGGCCATTCACTCGGCGTCGCTTTCCCGGTGTGAGGCCGGTTCAGCCCGTTGCCTCTGGTCTGCCTGGACCTATAGTTGAAACTTTAG 

- UNI11567 - - UNI15525 - - UNI21674 - TGCCATGGCAGAACAGGATGTGGAAAATGAACTTTTGGATTATGATGAAGATGAAGAGCCC

CAGGCACCCCAGGAGAGCACTCCAGCTCCCCCGAAGAAAGATGTCAAAGGATCTTATGTCTCCATCCACAGTTCTGGCTTCCGGGACTTTCTACTGAAGC

CAGAGCTCCTGAGAGCTATAGTTGACTGTGGCTTTGAGCATCCTTCAGAGG - UNI21674 - TCCAGCATGAGTGTATTCCCCAGGCCATTCTGGGT

ATGGATGTCCTGTGCCAGGCCAAGTCTGGGATGGGCAAGACAGCTGTGTTTGTGCTGGCCACCCTGCAGCAGATTGAGCCTGTCAATGGCCAG GTATCA

GTCCTGGTCATGTGCCACACGAGGGAGCTGGCCTTCCAGATCAGCAAGGAGTATGAGCGCTTCTCTAAGTACATGCCCAGTGTTAAG GTTTCTGTGTTC

TTTGGAGGCCTCTCCATTAAGAAGGATGAAGATGTGTTGAAGAAGAACTGTCCTCATGTTGTGGTGGGGACACCAGGCCGGATCCTGGCACTTGTGCGGA

GCAGGAGCCTCAACCTGAGGAATGTGAAGCACTTTGTGCTAGATGAATGTGACAAGATGCTGGAACAGCTGG - UNI3972 - ACATGCGCCGGGATG

TACAGGAGATCTTTCGTCTGACACCCCACGAGAAGCAGTGTATGATGTTCAGCGCCACCCTGAGCAAGGAGATCCGGCCAGTCTGCAGGAAGTTCATGCA

GGAT - UNI3972 - CCTATGGAGGTGTTTGTGGACGACGAGACCAAGCTCACACTGCATGGGCTGCAGCAGTATTACGTCAAGCTCAAGGACAGTGA

GAAGAACCGTAAGCTCTTCGACCTCCTCGACGTGCTAGAGTTTAACCAG GTGGTGATCTTTGTCAAGTCTGTGCAACGCTGCATGGCCCTGGCCCAGCT

CCTAGTGGAGCAGAATTTCCCAGCTATCGCTATTCACCGAGGCATGGCCCAGGAGGAGCG CCTGTCCCGATACCAGCAGTTCAAGGACTTCCAGCGACG

AATCCTGGTGGCTACTAATCTGTTTGGCAGAGGTATGGACATTGAGCGAGTCAACATTGTCTTCAACTATGACATGCCAGAGGACTCAGACACCTACCTT

CACCGA GTGGCTCGTGCTGGTCGCTTTGGTACCAAGGGCCTGGCAGTCACTTTTGTATCGGATGAAAATGATGCCAAAATCCTTAATGATGTTCAGGAC

CGGTTTGAAGTGAATGTAGCTGAGCTTCCAGAGGAAATAGATATCTCCACATACA TTGAGCAGAGCCGGTAACCGTATGTGTAGCCAGGGCAACATGGC

CACTCTCTTTCCCACCTGCTGCTTCAGAACCTCTTTCTAGGTGACAAATCGATGTCTCTTTTTATTGTTCCAAAGCTTTAGTGATGTAAGAATAAACTTT

TATTGTGAATGCATGGCTCCAGCCCCATCCCTTTCGGTCAACATCTCATGGGGTTGGGTCAAGCCAGCAAACTTCTCACC
Translation
 - UNI11567 - - UNI15525 - - UNI21674 - MAEQDVENELLDYDEDEEPQAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIV

DCGFEHPSEV - UNI21674 - VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQ VSVLVMCHTRELAFQISKEYERFSKYMPSVK 

VSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDECDKMLEQLD - UNI3972 - DMRRDVQEIFRLTPHEKQCMMFSAT

LSKEIRPVCRKFMQD - UNI3972 - PMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQ VVIFVKSVQRCMALAQLLVEQNFPAIA

IHRGMAQEER RLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHR VARAGRFGTKGLAVTFVSDENDAKILNDVQDRFEVNVAE

LPEEIDISTYI IEQSR
Transcript ENSMUST00000019576
Sequence
GTCCAGGGTCGCGGCGTAGAACCGGACGGGTGGCTCTCTTTGCAGCTCGCGGAGGCGAACCGGGCGGCAG - UNI10950 - - UNI11567 - - U

NI15525 - - UNI21674 - TGCCATGGCAGAACAGGATGTGGAAAATGAACTTTTGGATTATGATGAAGATGAAGAGCCCCAGGCACCCCAGGAGA

GCACTCCAGCTCCCCCGAAGAAAGATGTCAAAGGATCTTATGTCTCCATCCACAGTTCTGGCTTCCGGGACTTTCTACTGAAGCCAGAGCTCCTGAGAGC

TATAGTTGACTGTGGCTTTGAGCATCCTTCAGAGG - UNI21674 - TCCAGCATGAGTGTATTCCCCAGGCCATTCTGGGTATGGATGTCCTGTGCC

AGGCCAAGTCTGGGATGGGCAAGACAGCTGTGTTTGTGCTGGCCACCCTGCAGCAGATTGAGCCTGTCAATGGCCAG GTATCAGTCCTGGTCATGTGCC

ACACGAGGGAGCTGGCCTTCCAGATCAGCAAGGAGTATGAGCGCTTCTCTAAGTACATGCCCAGTGTTAAG GTTTCTGTGTTCTTTGGAGGCCTCTCCA

TTAAGAAGGATGAAGATGTGTTGAAGAAGAACTGTCCTCATGTTGTGGTGGGGACACCAGGCCGGATCCTGGCACTTGTGCGGAGCAGGAGCCTCAACCT

GAGGAATGTGAAGCACTTTGTGCTAGATGAATGTGACAAGATGCTGGAACAGCTGG - UNI3972 - ACATGCGCCGGGATGTACAGGAGATCTTTCG

TCTGACACCCCACGAGAAGCAGTGTATGATGTTCAGCGCCACCCTGAGCAAGGAGATCCGGCCAGTCTGCAGGAAGTTCATGCAGGAT - UNI3972 -

 CCTATGGAGGTGTTTGTGGACGACGAGACCAAGCTCACACTGCATGGGCTGCAGCAGTATTACGTCAAGCTCAAGGACAGTGAGAAGAACCGTAAGCTC

TTCGACCTCCTCGACGTGCTAGAGTTTAACCAG GTGGTGATCTTTGTCAAGTCTGTGCAACGCTGCATGGCCCTGGCCCAGCTCCTAGTGGAGCAGAAT

TTCCCAGCTATCGCTATTCACCGAGGCATGGCCCAGGAGGAGCG CCTGTCCCGATACCAGCAGTTCAAGGACTTCCAGCGACGAATCCTGGTGGCTACT

AATCTGTTTGGCAGAGGTATGGACATTGAGCGAGTCAACATTGTCTTCAACTATGACATGCCAGAGGACTCAGACACCTACCTTCACCGA GTGGCTCGT

GCTGGTCGCTTTGGTACCAAGGGCCTGGCAGTCACTTTTGTATCGGATGAAAATGATGCCAAAATCCTTAATGATGTTCAGGACCGGTTTGAAGTGAATG

TAGCTGAGCTTCCAGAGGAAATAGATATCTCCACATACA TTGAGCAGAGCCGGTAACCGTATGTGTAGCCAGGGCAACATGGCCACTCTCTTTCCCACC

TGCTGCTTCAGAACCTCTTTCTAGGTGACAAATCGATGTCTCTTTTTATTGTTCCAAAGCTTTAGTGATGTAAGAATAAACTTTTATTGTG
Translation
 - UNI10950 - - UNI11567 - - UNI15525 - - UNI21674 - MAEQDVENELLDYDEDEEPQAPQESTPAPPKKDVKGSYVSIHSSGFR

DFLLKPELLRAIVDCGFEHPSEV - UNI21674 - VQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQ VSVLVMCHTRELAFQISKE

YERFSKYMPSVK VSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDECDKMLEQLD - UNI3972 - DMRRDVQEIFRL

TPHEKQCMMFSATLSKEIRPVCRKFMQD - UNI3972 - PMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQ VVIFVKSVQRCMAL

AQLLVEQNFPAIAIHRGMAQEER RLSRYQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHR VARAGRFGTKGLAVTFVSDENDAKIL

NDVQDRFEVNVAELPEEIDISTYI IEQSR

For any suggestions or comments, please send an email to unitrap@crg.es