Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005501 (Usp40)
Chromosomal location
Chr 1: 89841696 - 89905126 (-)
Description
ubiquitin specific peptidase 40 Gene [Source:MGI Symbol;Acc:MGI:2443184]
RefSeq_dna
NM_001033291 
RefSeq_peptide
NP_001028463.1 
UniGene
Mm.80484 
MGI
MGI:2443184 
Uniprot/SWISSPROT
Q8BWR4 
Human Ortholog
ENSG00000085982 (USP40)
Omim not available
UniTrap UNI20663
Vector Insertion
Chr 1: 89904018 - 89905012
Public Clones not available
Private Clones OST355437 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113153
Sequence
TTTCCAGAGACACGGCCTCCTCGGCATGGCGGTGCCCGTTCGGAGCGAGTTCGTTTACTCTGTGCTGTGGCCGGGGCGGGGGTCTGGGCTATAGGCA - 

UNI20663 - GATAGCGTTTAGTTCCACCATGTTTGGGAACCTATTTGAAGAGGATTATTCCAGTGTGTCAAGTAGTCAGTATGGAAGAGGGAAGAAAT

TAAAGACTAAAGGTTTGGAGCCGCCTGCCCCTAGAGAATTCACCAATTTAAGTGGAATCAGAAATCAGGGTGGAACCTGTTACCTCAGCTCCCTTCTTCA

GACGCTTCATTTCACACCTGAATTCAGAG AAGCTTTATTTTCTCTTGGTCCGGAAGAGCTGGGTTCTTTAGAGGATAAAGATAAACCTGATGCAAAG G

TTCGGATCATACCTTTGCAGTTGCAGCGCTTGTTTGCCCAGCTTCTGCTCTTGGACCAGGAGGCTGCATCTACCATAGACCTCACCGACAGCTTCGGGTG

GACCAACGATGAG GAAATGAGGCAACATGATGTGCAGGAACTCAACCGAATTCTCTTCAGTGCTTTGGAAACTTCTTTAGTTGGGACCTCTGGCCATGA

CCTCATTCATCGTCTATACCATGGCACCATTGTGAACCAGATTGTTTGCAAAGAGTGTAAGAACATCAGTGAGAGGCAG GAAGACTTCTTGGATTTGAC

AGTAGCAGTCAAAAATGTATCTGGTTTAGAAGATGAACTCTGCAACATGTATGTGGAGGAAGAAATTTTTGACTATGACAACCTGTACCACTGTGGAACC

TGTGACCGACTGGTTAAAGCAGCAAAG TCTGCCAAATTGCGTAAGCTGCCTCCTTTTCTTACTATTTCATTACTAAGATTTAATTTTGATTTTGTGAAA

TGTGAACGCTACAAGGATACTAGCTGTTATACATTCCCCCTCCGGATCAATCTCAAGCCTTTCTGTGAACAG AGTGAACTGGATGACATGGAATATATG

TATGACCTCTTCTCCGTCATTATCCACAAAGGTGGCTGCTATGGAGGTCATTACCATGTGTACATTAAAGATGTTGATCATCTTGGCAACTGGCAATGTC

AA GAGGAGATAAGTGATACAAATGTGAATGTGAAAGCTCCTCAGAGTGAAGAAGAGGCTAATGATCCATTGGTGGTTCTAAAAACAATCTTATTGCAG 

GAGGAGGCCAATCAAATTCCTGTTGATCAACTGGGCCAGAAACTCTTGAAAAAAACAGGAATATCTTGGAACAAGAAGTACAGGAAACAGCATGGACCAC

TGCGAAAG TTCTTACAGCTCCATCCTCAGATATTTCTGCTCAGCACAGATGAAAGTACAGTTAGTCTCCTGAGGAACCATCTTACCCAGGCCCCATCTG

ACCTACAGAGCTGTGAACAGATTCTACATACACTTGCTTCAGAATCCCCAGGCTTGAATGATGACACCAGTTGCCCACACTGGTTTGATATCAATGATTC

CAAAGTCCATCCAATCAGAGAGAAAGATATCACACAGCAGTTCCAGGGTAAAGAAAGTGCCTACATGCTGTTTTATCGGAAAGCCACGTTACAAAGGCCC

CCTGAAG CTCGAGCCAATCCAAGATACAGAGTTCCATGTCACTTGCTGAAGGAAATGGATGCAGCCAACATTCTACTGCAGATGAGAAG GGCAGAATG

TGACTCTGCAAACAGTACTTTTGAGTTGCATCTTCATTTGGGTCCTCACTACCGTTTCTTCAATGGGGCTCTTCACCCTGCAGTCTCTGAGACAGAAAGC

GTGTGGGACTTAACGTTTGATAAAAGAAAAACTTTAGGAGATCTCCGTCAGTCAATATTTCAG CTATTGGAATGTTGGGAAGGAGACATGGTTCTTAGT

GTTGCGAAGCGTGTGCCAGCAGGACTTCATGTGTACCACACCCTCGATG GAGATGACTTGACACTGTGTGAAGCTGAGGTTGCTGATGGGGAAGACATC

TTTGTATGGAATGGGGTAGAG GTTGGTGGAGTCCAAATTCAGACTGGTTTTGATTGTGAACCTCTGCTGTTAAACATTCTTCATCTAGAACTAAGTGGT

GAAGGCTCAAAATGTGAGCAGTTGGTGGAGTCACCACATGTCTTTCCTGCTAATGCAGAAGTGGGCGCTGTGTTCACAGCCTTGGGCACCCCAGCAGGTG

CCATCCTCATGAACAGTGTGGAGTCTGCAGATGGAGAGTGCTGGACTGCTGTTCCCAAAGAAGACATGAAGAAGACGTTCAGAGAACAAGGTCTCAGAAA

TGGAAGCTTAATTTTGGTTCAAGATTCAGACAGTGATAATAACAG TCTGTTGCCCAAACAAGGGAGATGGACCAACAGCATGAATGAGCTCAACTGGCT

CCAAGTGAAAAATTTCTGCCAGTCAGAATCTGAAGAGAAGCAGGTTCAGATAGCCGTGACCATGCACACA GTGGTGTTTGATATTCGAATTAAAGCCAT

AAAGGAATTAAAATTAATGAAGGAACTAG CTGAGAACAGCTGTTTGAGACCCATTGATAGAAACGGGAAGCTTCTTTGTCCAG TCCCAGACAGTAGCA

CTTTGGAGGAAGCAGAGGTGAAGATGGGGAGCTCCGTGGGCCTGTGTCTGGGAAAAGCACCAACTTCCTCTCAG CTGTTCCTGTTTTTTGCTCTGGGGA

CTGACATTCACCCTGGGGCAGAGATGGACATCATAGTAGAAGAAACACTCTCAGTGAGAGAT TGTTTAAAGATAATGCTGGAGAAGTCAGGTCAGCAAG

 GAGAGATTTGGCACTTAAGGAAAATGGATTGGTGCTATGAAGCTGGTGAACCTTTATGTGAAGAG GATGCAACACTGAAAGAGCTTATGATACGTTCT

GGGGATACTTTGCTTTTAACTGAAGGGAAACTTCCTCCTCCG GGTCACTTGAAGATGCCCATCTGGTGGTACCAGCCTGCAAGGCTGTCAGGACACTGT

GAGAGTCGGGACCACTTAAACTGTGCCTTTTCTCAAGATAGCACCTGGAGGGCTGCTCCCACCCAAG GTGCTCCTGGCCCCGAGCCTGCAGAAGTCTCT

CTCCTCTACTTGGGGGATATGGAGATCTCAGAAGAGGCCACATTGGTGGAACTGAAGTCTCAG GCCTTGGCCTTGCCTTCTGTTTCGAAGCTCGCTGTC

CAGTCCACAGCCCTGCTCAGAGTCTGGACAGTGGAGAGCAAGCGCCCCAGCAGACTCTTGCGCACTAACTGGCGGCAGCTCAA GGAGTACAGACTGGGC

CGGAGAGCAGAGCTCTGCCTAGAGCTCCTTCAAAAAGAGGAGGACTTGGG GCCCCGAGATGTACTGCTGAGGACACAGCTACGCATCCCTGGTGAGAGA

GCCTACTCCCTGGCGACAGACCTGATATGGGACACCACCAGAGGATGGACTGCTGGCTCCTTGAGGCAGAGAGTAGCTGACTTCTATTCTCTTCCTGTGG

AGAAAATTGAAATTGCCAAATATTTTCCTGAAAAGTTTGAGTGGCTTCCAATATCTAGCTGG AATCAGCAAGTTGCCAAAAGAAAAAAGAAGAAAAACC

AAGATACTTTGCAAGGGGGACCATATTACTTGAAAGATGGAGACACTATTGGCATTAAG AATCTCCTGTTTGATGACAATGATGATTTCAGCACAATCA

GAGATGACATTGGAAAGGAGAACCAGAAGCGGCTAGCTTTGGAAAAAAAGAAAAG CCGAGAAGTCCACCGTGCACAGAGCAGCGATTTGTTCTCCAATG

CAGGGGTGCCCGCTAGGTTCCGGGGACCAGAAGCTTCTCTGTCCATCCACGTTGCAAGCTTCAGATAGCCCCTGCAGCAGTATTTCCTGTGCTTCAGACA

GAAGCATCCTGTCAGTTCTATGACAGACACCTTGTGGGTTTATGGTGGACAAGCTGGTTGCCTCCACAGCTAGTGATCTCAAGTCTTCAGCTTTGTGATA

GGCGAAGGGATGGCACTTCTC
Translation
 - UNI20663 - MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRNQGGTCYLSSLLQTLHFTPEFRE EALFSLGPEELGSLEDKD

KPDAK VRIIPLQLQRLFAQLLLLDQEAASTIDLTDSFGWTNDE EMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYHGTIVNQIVCKECKNISERQ

 EDFLDLTVAVKNVSGLEDELCNMYVEEEIFDYDNLYHCGTCDRLVKAAK SAKLRKLPPFLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQ 

SELDDMEYMYDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQCQ EEISDTNVNVKAPQSEEEANDPLVVLKTILLQ EEANQIPVDQLGQKLLKKTGISW

NKKYRKQHGPLRK FLQLHPQIFLLSTDESTVSLLRNHLTQAPSDLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHPIREKDITQQFQGKESAYM

LFYRKATLQRPPEA ARANPRYRVPCHLLKEMDAANILLQMRR RAECDSANSTFELHLHLGPHYRFFNGALHPAVSETESVWDLTFDKRKTLGDLRQSI

FQ LLECWEGDMVLSVAKRVPAGLHVYHTLDG GDDLTLCEAEVADGEDIFVWNGVE VGGVQIQTGFDCEPLLLNILHLELSGEGSKCEQLVESPHVFP

ANAEVGAVFTALGTPAGAILMNSVESADGECWTAVPKEDMKKTFREQGLRNGSLILVQDSDSDNNS SLLPKQGRWTNSMNELNWLQVKNFCQSESEEKQ

VQIAVTMHT VVFDIRIKAIKELKLMKELA AENSCLRPIDRNGKLLCPV VPDSSTLEEAEVKMGSSVGLCLGKAPTSSQ LFLFFALGTDIHPGAEMD

IIVEETLSVRD CLKIMLEKSGQQG GEIWHLRKMDWCYEAGEPLCEE DATLKELMIRSGDTLLLTEGKLPPP GHLKMPIWWYQPARLSGHCESRDHL

NCAFSQDSTWRAAPTQG GAPGPEPAEVSLLYLGDMEISEEATLVELKSQ ALALPSVSKLAVQSTALLRVWTVESKRPSRLLRTNWRQLK KEYRLGRR

AELCLELLQKEEDLG GPRDVLLRTQLRIPGERAYSLATDLIWDTTRGWTAGSLRQRVADFYSLPVEKIEIAKYFPEKFEWLPISSW NQQVAKRKKKKN

QDTLQGGPYYLKDGDTIGIK NLLFDDNDDFSTIRDDIGKENQKRLALEKKKS SREVHRAQSSDLFSNAGVPARFRGPEASLSIHVASFR
Transcript ENSMUST00000040783
Sequence
GGGTGGTTGGAAATCACTTTCCAGAGACACGGCCTCCTCGGCATGGCGGTGCCCGTTCGGAGCGAGTTCGTTTACTCTGTGCTGTGGCCGGGGCGGGGGT

CTGGGCTATAGGCA - UNI20663 - GATAGCGTTTAGTTCCACCATGTTTGGGAACCTATTTGAAGAGGATTATTCCAGTGTGTCAAGTAGTCAGTA

TGGAAGAGGGAAGAAATTAAAGACTAAAGGTTTGGAGCCGCCTGCCCCTAGAGAATTCACCAATTTAAGTGGAATCAGAAATCAGGGTGGAACCTGTTAC

CTCAGCTCCCTTCTTCAGACGCTTCATTTCACACCTGAATTCAGAG AAGCTTTATTTTCTCTTGGTCCGGAAGAGCTGGGTTCTTTAGAGGATAAAGAT

AAACCTGATGCAAAG GTTCGGATCATACCTTTGCAGTTGCAGCGCTTGTTTGCCCAGCTTCTGCTCTTGGACCAGGAGGCTGCATCTACCATAGACCTC

ACCGACAGCTTCGGGTGGACCAACGATGAG GAAATGAGGCAACATGATGTGCAGGAACTCAACCGAATTCTCTTCAGTGCTTTGGAAACTTCTTTAGTT

GGGACCTCTGGCCATGACCTCATTCATCGTCTATACCATGGCACCATTGTGAACCAGATTGTTTGCAAAGAGTGTAAGAACATCAGTGAGAGGCAG GAA

GACTTCTTGGATTTGACAGTAGCAGTCAAAAATGTATCTGGTTTAGAAGATGAACTCTGCAACATGTATGTGGAGGAAGAAATTTTTGACTATGACAACC

TGTACCACTGTGGAACCTGTGACCGACTGGTTAAAGCAGCAAAG TCTGCCAAATTGCGTAAGCTGCCTCCTTTTCTTACTATTTCATTACTAAGATTTA

ATTTTGATTTTGTGAAATGTGAACGCTACAAGGATACTAGCTGTTATACATTCCCCCTCCGGATCAATCTCAAGCCTTTCTGTGAACAG AGTGAACTGG

ATGACATGGAATATATGTATGACCTCTTCTCCGTCATTATCCACAAAGGTGGCTGCTATGGAGGTCATTACCATGTGTACATTAAAGATGTTGATCATCT

TGGCAACTGGCAATGTCAA GAGGAGATAAGTGATACAAATGTGAATGTGAAAGCTCCTCAGAGTGAAGAAGAGGCTAATGATCCATTGGTGGTTCTAAA

AACAATCTTATTGCAG GAGGAGGCCAATCAAATTCCTGTTGATCAACTGGGCCAGAAACTCTTGAAAAAAACAGGAATATCTTGGAACAAGAAGTACAG

GAAACAGCATGGACCACTGCGAAAG TTCTTACAGCTCCATCCTCAGATATTTCTGCTCAGCACAGATGAAAGTACAGTTAGTCTCCTGAGGAACCATCT

TACCCAGGCCCCATCTGACCTACAGAGCTGTGAACAGATTCTACATACACTTGCTTCAGAATCCCCAGGCTTGAATGATGACACCAGTTGCCCACACTGG

TTTGATATCAATGATTCCAAAGTCCATCCAATCAGAGAGAAAGATATCACACAGCAGTTCCAGGGTAAAGAAAGTGCCTACATGCTGTTTTATCGGAAAG

CCACGTTACAAAGGCCCCCTGAAG CTCGAGCCAATCCAAGATACAGAGTTCCATGTCACTTGCTGAAGGAAATGGATGCAGCCAACATTCTACTGCAGA

TGAGAAG GGCAGAATGTGACTCTGCAAACAGTACTTTTGAGTTGCATCTTCATTTGGGTCCTCACTACCGTTTCTTCAATGGGGCTCTTCACCCTGCAG

TCTCTGAGACAGAAAGCGTGTGGGACTTAACGTTTGATAAAAGAAAAACTTTAGGAGATCTCCGTCAGTCAATATTTCAG CTATTGGAATGTTGGGAAG

GAGACATGGTTCTTAGTGTTGCGAAGCGTGTGCCAGCAGGACTTCATGTGTACCACACCCTCGATG GAGATGACTTGACACTGTGTGAAGCTGAGGTTG

CTGATGGGGAAGACATCTTTGTATGGAATGGGGTAGAG GTTGGTGGAGTCCAAATTCAGACTGGTTTTGATTGTGAACCTCTGCTGTTAAACATTCTTC

ATCTAGAACTAAGTGGTGAAGGCTCAAAATGTGAGCAGTTGGTGGAGTCACCACATGTCTTTCCTGCTAATGCAGAAGTGGGCGCTGTGTTCACAGCCTT

GGGCACCCCAGCAGGTGCCATCCTCATGAACAGTGTGGAGTCTGCAGATGGAGAGTGCTGGACTGCTGTTCCCAAAGAAGACATGAAGAAGACGTTCAGA

GAACAAGGTCTCAGAAATGGAAGCTTAATTTTGGTTCAAGATTCAGACAGTGATAATAACAG TCTGTTGCCCAAACAAGGGAGATGGACCAACAGCATG

AATGAGCTCAACTGGCTCCAAGTGAAAAATTTCTGCCAGTCAGAATCTGAAGAGAAGCAGGTTCAGATAGCCGTGACCATGCACACA GTGGTGTTTGAT

ATTCGAATTAAAGCCATAAAGGAATTAAAATTAATGAAGGAACTAG GAGAGATTTGGCACTTAAGGAAAATGGATTGGTGCTATGAAGCTGGTGAACCT

TTATGTGAAGAG GATGCAACACTGAAAGAGCTTATGATACGTTCTGGGGATACTTTGCTTTTAACTGAAGGGAAACTTCCTCCTCCG GGTCACTTGAA

GATGCCCATCTGGTGGTACCAGCCTGCAAGGCTGTCAGGACACTGTGAGAGTCGGGACCACTTAAACTGTGCCTTTTCTCAAGATAGCACCTGGAGGGCT

GCTCCCACCCAAG GTGCTCCTGGCCCCGAGCCTGCAGAAGTCTCTCTCCTCTACTTGGGGGATATGGAGATCTCAGAAGAGGCCACATTGGTGGAACTG

AAGTCTCAG GCCTTGGCCTTGCCTTCTGTTTCGAAGCTCGCTGTCCAGTCCACAGCCCTGCTCAGAGTCTGGACAGTGGAGAGCAAGCGCCCCAGCAGA

CTCTTGCGCACTAACTGGCGGCAGCTCAA GGAGTACAGACTGGGCCGGAGAGCAGAGCTCTGCCTAGAGCTCCTTCAAAAAGAGGAGGACTTGGG GCC

CCGAGATGTACTGCTGAGGACACAGCTACGCATCCCTGGTGAGAGAGCCTACTCCCTGGCGACAGACCTGATATGGGACACCACCAGAGGATGGACTGCT

GGCTCCTTGAGGCAGAGAGTAGCTGACTTCTATTCTCTTCCTGTGGAGAAAATTGAAATTGCCAAATATTTTCCTGAAAAGTTTGAGTGGCTTCCAATAT

CTAGCTGG AATCAGCAAGTTGCCAAAAGAAAAAAGAAGAAAAACCAAGATACTTTGCAAGGGGGACCATATTACTTGAAAGATGGAGACACTATTGGCA

TTAAG AATCTCCTGTTTGATGACAATGATGATTTCAGCACAATCAGAGATGACATTGGAAAGGAGAACCAGAAGCGGCTAGCTTTGGAAAAAAAGAAAA

G CCGAGAAGTCCACCGTGCACAGAGCAGCGATTTGTTCTCCAATGCAGGGGTGCCCGCTAGGTTCCGGGGACCAGAAGCTTCTCTGTCCATCCACGTTG

CAAGCTTCAGATAGCCCCTGCAGCAGTATTTCCTGTGCTTCAGACAGAAGCATCCTGTCAGTTCTATGACAGACACCTTGTGGGTTTATGGTGGACAAGC

TGGTTGCCTCCACAGCTAGTGATCTCAAGTCTTCAGCTTTGTGATAGGCGAAGGGATGGCACTTCTCAGACCAAACAAGTGTGCCTGGTTACTAGCTCTG

TGACACAGCAGCTGCAGAGCCGGCTCAGACTCAGACACTATGCCCGGAATAGACCTCTTACCTGTGGCCTCTTTCCAGAAAGTATACTTCTGGACAATGG

CAAGTTGCTCAAAGAGGACAAATCTGATAGGTAAGCCACAAGATCAGTTACTTACCCACTCCTGAGGTGACCAGTTAGTCATCTAGTTCTGGCACCTTAC

TGAAGCTGCAAGGAAGGATGTGTGTCCTGACTCCATTCCCAGTTTTCCAGTCCTCACTATGCCATGTGCCTCCTCTTGAGCCAAATTCAAAGTAGGACTC

TAAGCCAGCTTGCAGGAAAAGCTATGTATGGCATTCACCTACTGTGTTATCTACCACCTATGCACTCTGGCCAGAGACGGGACCATCAAAGAAGCCTAGC

ACAACAAATCCAGGCTCCCATTTGTCTTGGGGAAACTGAGGCCTCCTCCTTCTCAGTCAGCACAGGTAACTGATTGAAGAGATTTGGTATTTATGTACTG

TAATTAATACACTATCAAAACAGCATCTATTACTGAACTAGCAGGTTTAGGACCCTGGGCTGACTTAGCCTATGACAGACAGTATTCCTAAGAGGAATTG

TCAGGGTATCAGTTTCTTACCAGCTTTTACATGTCTTCCTGTAACAGAACTGATGTGGTGTAAGACAAAGAAAAAGTTACTCTGGCCTGGGCTTCAGCTA

GCCCCTGCTGGCTTTTCACATTTCTGGTGCAGCTATGCTGGCTTCTCTGTGGAGCTGATGCTCAGCTGGTAATCTTGCTCTTCCTTTGTCTTCCCAACAT

CATTTGCCAGAGTTGATGTCATGTTAGGTGACTGATTCTATTGAAGCACTTGTATTATAAGATGTTGGACTTGGACTAGTTACCTTTTCTGGCCATGTCC

TTGTAGCTACACACCAAGAGGTTCTGGGAGACCCAAACAGTAAACATTACTTGACCACAACTGAGCCCTCTGGATACTGGATACTGTTTCTTGTACTGTA

ACTGACATGGTTCCTTAGTTTGTCCCCAGGCAATACAGTCCTGATGTACTAGCTCAGACACTTTGCTTTCAGGAAGCCAGAGGCTCCCTGACCCTCTTAG

TACCTGGAGGAGCCAGAAGACATGCCTCAAGTGCTAGCTGCAGCCTAAGTCTGTTGACAGGCCTATCTGGTTGGTTTCTTTTGTGTGTGTGTGTGTGTGT

GTGTTTGGAGAACAGAATAGACAAAACAGGGAAAAACACTAAGACTTTATTAAAGAAAAAAATAAAACATTCTTAAAGTTGCAGTCCTC
Translation
 - UNI20663 - MFGNLFEEDYSSVSSSQYGRGKKLKTKGLEPPAPREFTNLSGIRNQGGTCYLSSLLQTLHFTPEFRE EALFSLGPEELGSLEDKD

KPDAK VRIIPLQLQRLFAQLLLLDQEAASTIDLTDSFGWTNDE EMRQHDVQELNRILFSALETSLVGTSGHDLIHRLYHGTIVNQIVCKECKNISERQ

 EDFLDLTVAVKNVSGLEDELCNMYVEEEIFDYDNLYHCGTCDRLVKAAK SAKLRKLPPFLTISLLRFNFDFVKCERYKDTSCYTFPLRINLKPFCEQ 

SELDDMEYMYDLFSVIIHKGGCYGGHYHVYIKDVDHLGNWQCQ EEISDTNVNVKAPQSEEEANDPLVVLKTILLQ EEANQIPVDQLGQKLLKKTGISW

NKKYRKQHGPLRK FLQLHPQIFLLSTDESTVSLLRNHLTQAPSDLQSCEQILHTLASESPGLNDDTSCPHWFDINDSKVHPIREKDITQQFQGKESAYM

LFYRKATLQRPPEA ARANPRYRVPCHLLKEMDAANILLQMRR RAECDSANSTFELHLHLGPHYRFFNGALHPAVSETESVWDLTFDKRKTLGDLRQSI

FQ LLECWEGDMVLSVAKRVPAGLHVYHTLDG GDDLTLCEAEVADGEDIFVWNGVE VGGVQIQTGFDCEPLLLNILHLELSGEGSKCEQLVESPHVFP

ANAEVGAVFTALGTPAGAILMNSVESADGECWTAVPKEDMKKTFREQGLRNGSLILVQDSDSDNNS SLLPKQGRWTNSMNELNWLQVKNFCQSESEEKQ

VQIAVTMHT VVFDIRIKAIKELKLMKELG GEIWHLRKMDWCYEAGEPLCEE DATLKELMIRSGDTLLLTEGKLPPP GHLKMPIWWYQPARLSGHCE

SRDHLNCAFSQDSTWRAAPTQG GAPGPEPAEVSLLYLGDMEISEEATLVELKSQ ALALPSVSKLAVQSTALLRVWTVESKRPSRLLRTNWRQLK KEY

RLGRRAELCLELLQKEEDLG GPRDVLLRTQLRIPGERAYSLATDLIWDTTRGWTAGSLRQRVADFYSLPVEKIEIAKYFPEKFEWLPISSW NQQVAKR

KKKKNQDTLQGGPYYLKDGDTIGIK NLLFDDNDDFSTIRDDIGKENQKRLALEKKKS SREVHRAQSSDLFSNAGVPARFRGPEASLSIHVASFR

For any suggestions or comments, please send an email to unitrap@crg.es