Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000005534 (Insr)
Chromosomal location
Chr 8: 3155401 - 3279128 (-)
Description
insulin receptor Gene [Source:MGI (curated);Acc:Insr-001]
RefSeq_dna
NM_010568 
RefSeq_peptide
NP_034698.2 
UniGene
Mm.268003 
MGI
MGI:96575 
Uniprot/SWISSPROT
P15208 
Uniprot/SPTREMBL
O35466 Q3TPM5 Q3V313 
Human Ortholog
ENSG00000171105 (INSR)
Omim 125853 - DIABETES MELLITUS, NONINSULIN-DEPENDENT  246200 - DONOHUE SYNDROME  262190 - PINEAL HYPERPLASIA, INSULIN-RESISTANT DIABETES MELLITUS, AND SOMATIC  609968 - HYPERINSULINEMIC HYPOGLYCEMIA, FAMILIAL, 5  610549 - DIABETES MELLITUS, INSULIN-RESISTANT, WITH ACANTHOSIS NIGRICANS  
UniTrap UNI26585
Vector Insertion
Chr 8: 3258935 - 3279028
Public Clones (sanger) IST10055E6 (tigm) IST10340B11 (tigm) IST14946E12 (tigm) IST13269D7 (tigm)
IST10099A11 (tigm) IST14073F1 (tigm) IST13583E9 (tigm) IST13615E8 (tigm)
IST15108A8 (tigm) IST13583E12 (tigm) IST13583E8 (tigm) IST13583E2 (tigm)
IST14407A11 (tigm) IST13583E1 (tigm) IST14735C4 (tigm) IST14424F12 (tigm)
IST11318G8 (tigm) IST14277A6 (tigm) IST12229F5 (tigm) IST10823C5 (tigm)
IST13974A12 (tigm)
Private Clones OST109271 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30983
Vector Insertion
Chr 8: 3198060 - 3203035
Public Clones IST10555B5 (tigm) IST11599G3 (tigm) IST11552A9 (tigm) IST11657B3 (tigm)
IST10314A10 (tigm) IST14843A4 (tigm) IST14396E9 (tigm) IST10844D2 (tigm)
IST12058G2 (tigm) IST10609D10 (tigm) IST10901F5 (tigm) IST10453B11 (tigm)
IST14464F11 (tigm) IST15095B10 (tigm) IST11054C2 (tigm) IST10851G5 (tigm)
IST14446A3 (tigm) IST12875D3 (tigm) IST10668H3 (tigm) IST10119D5 (tigm)
IST10382C11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31415
Vector Insertion
Chr 8: 3174613 - 3185153
Public Clones IST14867C6 (tigm) IST13486D10 (tigm) IST14508H10 (tigm) IST14203A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33012
Vector Insertion
Chr 8: 3167501 - 3169869
Public Clones IST11681G11 (tigm) IST11449C12 (tigm) IST11731B9 (tigm) IST14606C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091291
Sequence
ATGGGCTTCGGGAGAGGATGTGAGACGACGGCTGTGCCATTGCTGGTGGCCGTGGCCGCGTTGCTGGTGGGCACAGCCGGCCACCTGTACCCTGGAGAGG

 - UNI26585 - TGTGCCCTGGTATGGACATCCGGAACAACCTGACCAGGCTACATGAGCTGGAGAACTGCTCAGTCATTGAGGGCCATCTGCAGATC

CTCCTGATGTTCAAGACCAGACCCGAAGATTTCCGAGACCTCAGTTTCCCCAAACTCATCATGATCACAGATTACCTGCTTCTCTTCCGTGTCTATGGTC

TGGAAAGTCTGAAAGACCTCTTCCCAAATCTCACAGTCATCCGAGGCTCCCGTCTCTTCTTCAACTATGCCCTGGTTATCTTCGAGATGGTCCACCTGAA

GGAGCTGGGGCTTTATAACCTCATGAACATCACCCGGGGCTCTGTCCGCATCGAGAAGAATAATGAGCTCTGCTACCTGGCCACTATCGACTGGTCCCGT

ATCCTGGATTCTGTGGAGGACAACTACATTGTACTGAACAAAGATGACAACGAGGAATGTGGGGATGTCTGTCCAGGCACCGCCAAGGGCAAGACCAACT

GTCCTGCCACTGTCATCAATGGGCAGTTTGTGGAACGGTGCTGGACACACAGTCATTGTCAGAAAG TTTGCCCAACCATCTGTAAGTCACATGGCTGCA

CAGCTGAAGGCCTGTGCTGCCACAAAGAGTGCCTGGGCAACTGTTCGGAACCTGATGACCCCACCAAGTGTGTGGCCTGTCGCAACTTCTATCTGGATGG

TCAGTGTGTGGAGACCTGCCCGCCACCCTACTATCACTTCCAGGACTGGCGCTGTGTGAACTTCAGCTTCTGCCAAGACCTTCACTTCAAATGCAGGAAC

TCTCGGAAGCCTGGCTGCCACCAATACGTCATTCACAACAATAAGTGCATCCCCGAGTGCCCGTCTGGCTATACCATGAATTCCAGCAA CTTGATGTGC

ACCCCATGTCTGGGACCCTGCCCTAAGGTCTGCCAAATCCTCGAAGGTGAGAAGACCATTGATTCTGTGACATCTGCCCAGGAGCTCCGAGGCTGCACTG

TGATCAACGGTAGCCTGATCATCAACATCCGAGGGGGCA - UNI30983 - ACAACCTGGCAGCTGAGCTGGAGGCTAACCTTGGCCTCATTGAAGAA

ATTTCGGGATTTCTAAAGATCCGCCGCTCCTATGCTCTGGTATCACTTTCTTTCTTCAGGAAGCTACATCTGATTCGAGGAGAGACCTTGGAAATTGG -

 UNI30983 - GAACTATTCTTTTTATGCCTTGGACAACCAGAACCTGAGGCAACTCTGGGACTGGAGCAAACACAACCTCACCATCACTCAGGGCAAG

CTCTTCTTCCATTACAACCCGAAACTCTGCTTGTCTGAAATTCACAAGATGGAAGAAGTCTCCGGAACTAAGGGCCGTCAGGAGAGGAACGACATTGCCC

TGAAGACCAATGGGGACCAGGCATCGT - UNI30983 - GTGAAAATGAATTGCTTAAATTTTCTTTCATTCGGACATCTTTTGACAAGATCCTGTTG

AGGTGGGAACCCTACTGGCCCCCCGACTTCCGAGATCTCCTGGGATTCATGTTGTTCTACAAAGAGGC CCCTTATCAGAATGTGACAGAGTTTGATGGG

CAGGATGCTTGTGGCTCCAACAGCTGGACTGTGGTGGATATTGACCCGCCCCAGAGGTCCAACGACCCCAAGTCTCAGACCCCAAGCCACCCTGGGTGGC

TGATGCGGGGCCTCAAACCCTGGACCCAATACGCCATCTTTGTGAAGACCTTGGTTACCTTCTCTGATGAACGGCGGACCTATGGAGCCAAAAGTGATAT

CATCTATGTGCAAACAGATGCCACTA ATCCTTCTGTCCCCCTGGATCCCATATCAGTTTCTAATTCCTCATCTCAGATTATCTTAAAGTGGAAGCCCCC

CTCTGACCCCAATGGCAACATCACACACTACCTGGTGTACTGGGAGAGGCAAGCAGAGGACAGCGAGCTGTTTGAGCTGGATTATTGTCTCAAAG - UN

I31415 - GGCTGAAGCTCCCTTCACGGACCTGGTCCCCACCCTTTGAGTCTGATGATTCTCAGAAGCACAATCAGAGTGAGTATGACGACTCGGCCAG

TGAGTGCTGCTCATGCCCTAAGACTGACTCTCAGATCCTGAAGGAGCTGGAGGAGTCTTCATTCAGGAAGACCTTCGAGGATTACCTGCACAACGTGGTT

TTTGTCCCCAG - UNI31415 - GCCATCCCGAAAGCGAAGATCCCTTGAAGAGGTGGGGAATGTGACAGCCACCACACTCACACTTCCAGATTTCCC

CAACGTCTCCTCTACCATTGTGCCCACAAGTCAGGAGGAGCACAGGCCATTTGAGAAAGTGGTGAACAAGGAGTCACTTGTCATCTCTGGCCTGAGACAC

TTCACTGGGTACCGCATTGAGCTGCAGGCATGCAATCAAGATTCCCCAGATGAGAGGTGCAGTGTGGCTGCCTACGTCAGTGCCCGGACCATGCCTGAAG

 - UNI31415 - CTAAGGCAGATGACATCGTTGGCCCTGTGACTCATGAAATCTTTGAGAACAATGTTGTACACTTAATGTGGCAAGAGCCAAAGGAA

CCTAATGGTCTGATTGTGCTATATGAAGTGAGCTATCGCCGATATGGTGATGAG - UNI33012 - GAGCTGCACCTCTGTGTCTCCCGGAAGCATTT

TGCCCTGGAGCGGGGCTGCAGGCTGCGAGGGCTCTCCCCAGGAAACTACAGTGTTCGAGTCCGGGCTACCTCTCTGGCAGGAAATGGCTCCTGGACAGAA

CCCACCTATTTTTATGTGACTGATTATT - UNI33012 - TAGATGTCCCATCAAATATTGCCAAAATTATCATTGGACCCCTCATCTTTGTCTTCCT

CTTCAGTGTTGTGATTGGAAGTATTTATCTATTTCTGAGAAAGAG - UNI33012 - GCAGCCGGATGGGCCAATGGGACCACTGTATGCATCTTCAA

ACCCTGAGTACCTCAGTGCCAGTGATG TGTTTCCATCTTCTGTGTACGTGCCGGACGAGTGGGAGGTGCCTCGAGAGAAGATCACCCTTCTTCGAGAGC

TGGGGCAGGGATCCTTTGGTATGGTGTATGAAGGCAATGCCAAGGATATCATCAAGGGTGAGGCAGAGACCCGTGTTGCGGTTAAGACTGTCAATGAGTC

AGCCAGTCTTCGAGAACGGATCGAGTTCCTCAATGAGGCATCAGTCATGAAGGGATTCACCTGCCATCATGTG GTCCGCCTTCTTGGGGTGGTATCCAA

AGGACAGCCAACGCTGGTAGTGATGGAATTGATGGCTCATGGAGACCTGAAAAGTCACCTCCGTTCTCTGAGGCCAGATGCTGAG AATAACCCAGGCCG

CCCTCCCCCTACCTTGCAAGAAATGATTCAGATGACAGCAGAAATTGCTGATGGCATGGCATACTTGAACGCCAAGAAGTTTGTGCACCGGGACCTGGCA

GCTCGAAACTGCATGGTTGCCCATGATTTTACTGTCAAAATTGGAG ACTTTGGAATGACAAGGGACATCTACGAGACAGATTACTATCGGAAAGGGGGC

AAGGGACTGCTTCCTGTGAGGTGGATGTCACCTGAGTCCCTGAAGGATGGAGTCTTTACTGCTTCTTCTGATATGTG GTCCTTTGGGGTGGTCCTTTGG

GAAATCACTAGCCTGGCTGAGCAACCTTATCAAGGCCTGTCTAATGAACAGGTGTTGAAGTTTGTCATGGATGGAGGCTATCTGGATCCCCCTGATAACT

GTCCAGAGAGACT CACTGACCTGATGCGCATGTGCTGGCAGTTCAACCCCAAGATGAGGCCAACCTTCCTGGAAATCGTCAACCTGCTCAAGGATGACC

TCCACCCCAGCTTTCCAGAAGTTTCCTTCTTCTACAGCGAGGAGAACAAGGCTCCTGAGAGTGAGGAGCTGGAGATGGAGTTTGAAGACATGGAGAATGT

CCCGTTGGATCGTTCCTCTCACTGTCAGAGAGAAGAGGCTGGGGGCCGGGAGGGAGGGTCCTCACTGAGCATCAAACGGACCTATGATGAACACATCCCC

TATACCCACATGAATGGGGGCAAGAAGAACGGACGTGTCCTTACCCTGCCAAGGTCAAACCCTTCCTAACAGCGCCTTCTCCGGGAAGGATTCTTTTCTT

TCTTTCTTTTTTAAAACTCTTCTGTAGTTTGACTGCCTCCAGGAAACTCAGGATTATCAGGACTCTGCCCAGATGTGAAACTGAGCTCAGAGATAGTTCA

TACACATTTCTGTTTGTCTTTTGACCTGAAAACACACAAGCGTGATCGCCAACCCTGTAAGCCTGTGGAGGGCTAACTGTGAACCTAGAGGGGTTGGGCT

GTCCATGCTCCCTTCCCTGCCTCCACCGTATCAAACC
Translation
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEV - UNI26585 - VCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMIT

DYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDV

CPGTAKGKTNCPATVINGQFVERCWTHSHCQKV VCPTICKSHGCTAEGLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNF

SFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSN NLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGN - UNI

30983 - NNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIG - UNI30983 - GNYSFYALDNQNLRQLWDWSKHNLTITQG

KLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASC - UNI30983 - CENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKE

A APYQNVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATN NPSVPLDPIS

VSNSSSQIILKWKPPSDPNGNITHYLVYWERQAEDSELFELDYCLKG - UNI31415 - GLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKT

DSQILKELEESSFRKTFEDYLHNVVFVPR - UNI31415 - RPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPTSQEEHRPFEKVVNKESLVISGL

RHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEA - UNI31415 - AKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE - 

UNI33012 - ELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYL - UNI33012 - LDVPSNIAKIIIGPLIFVFLF

SVVIGSIYLFLRKR - UNI33012 - RQPDGPMGPLYASSNPEYLSASDV VFPSSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAE

TRVAVKTVNESASLRERIEFLNEASVMKGFTCHHV VRLLGVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAE NNPGRPPPTLQEMIQMTAEIADGMAY

LNAKKFVHRDLAARNCMVAHDFTVKIGD DFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMW WSFGVVLWEITSLAEQPYQGLSNEQV

LKFVMDGGYLDPPDNCPERL LTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGR

EGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS

For any suggestions or comments, please send an email to unitrap@crg.es